KEGG   Sodalis glossinidius (Glossina spp.): SG1261Help
Entry
SG1261            CDS       T00316                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SG1261 (ruvA)
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SG1261 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121798..2122415
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPQVLLETHGVGYEVFMPMTCFYALPETGQEAVIFTHFVVREDAQLL
FGFIHKQERVLFRELIKVNGVGPKLALAILSGMSAQQFISAVERQEINALVKLPGVGKKT
AERLVVEMKDRFKGLSGDLFVPQGAGEIPAAIDAPAMPADPEGEAVAALVALGYKPQEAS
RMVSKVASAGSDCEMLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtctcagaggcatcattctggaaaagcagccgccgcaggtgctattggaa
acccatggggtagggtatgaggtcttcatgccgatgacctgtttctatgccctgccggag
accggccaggaggcggtcatctttacccatttcgtggtacgtgaggatgcccaactgctg
tttggctttattcataaacaggagcgggtgctgtttcgcgagcttattaaagtcaacggg
gtcgggccaaagctggcgctggccattttgtccggcatgtcggcgcaacagtttatcagc
gccgtggaacgccaggaaatcaacgccctggtgaaattgcccggcgtcggtaagaagact
gcggaacggctggtggtggaaatgaaggacaggttcaaaggcctgtccggcgatctgttt
gtgccacagggcgcgggcgagatccctgccgccatcgatgcgccggccatgcctgccgat
cccgagggtgaagcggtggctgccctggtggcgctgggttataaaccgcaggaggcaagc
cggatggtaagtaaagtagccagcgccggctctgattgtgaaatgctaatccgtgatgct
ctgcgcgctgcgctgtga

DBGET integrated database retrieval system