KEGG   Sodalis glossinidius: SG1261Help
Entry
SG1261            CDS       T00316                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgl  Sodalis glossinidius
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sgl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2121798..2122415
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIILEKQPPQVLLETHGVGYEVFMPMTCFYALPETGQEAVIFTHFVVREDAQLL
FGFIHKQERVLFRELIKVNGVGPKLALAILSGMSAQQFISAVERQEINALVKLPGVGKKT
AERLVVEMKDRFKGLSGDLFVPQGAGEIPAAIDAPAMPADPEGEAVAALVALGYKPQEAS
RMVSKVASAGSDCEMLIRDALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggacgtctcagaggcatcattctggaaaagcagccgccgcaggtgctattggaa
acccatggggtagggtatgaggtcttcatgccgatgacctgtttctatgccctgccggag
accggccaggaggcggtcatctttacccatttcgtggtacgtgaggatgcccaactgctg
tttggctttattcataaacaggagcgggtgctgtttcgcgagcttattaaagtcaacggg
gtcgggccaaagctggcgctggccattttgtccggcatgtcggcgcaacagtttatcagc
gccgtggaacgccaggaaatcaacgccctggtgaaattgcccggcgtcggtaagaagact
gcggaacggctggtggtggaaatgaaggacaggttcaaaggcctgtccggcgatctgttt
gtgccacagggcgcgggcgagatccctgccgccatcgatgcgccggccatgcctgccgat
cccgagggtgaagcggtggctgccctggtggcgctgggttataaaccgcaggaggcaagc
cggatggtaagtaaagtagccagcgccggctctgattgtgaaatgctaatccgtgatgct
ctgcgcgctgcgctgtga

DBGET integrated database retrieval system