KEGG   Sodalis glossinidius: SG1346Help
Entry
SG1346            CDS       T00316                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sgl  Sodalis glossinidius
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgl00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2239539..2240411)
Genome map
AA seq 290 aa AA seqDB search
MSDSLLALPVKQTLSPSLTLRQQDQLLLVAVDHPQVRAAITLQGAHLIAWQPTGEQPVLW
LSEKSAFQEGLAIRGGVPICWPWFGKIATPNHGFARILPWELSDHSEDGQQVQLTFTLRD
STLTEPFFPHPFTLKAHFTLGQTCSIELVAEGEYQATAALHSYFTVGAIGDIHVSGLGAN
FIDKVNGALPAQQQGDLTFSGEVDRVYTAPAETSLIHDPVLGRVIEVHHQHHSDVVSWNC
GQSLSQSIGDLADDSYLSYVCVETARVNAPLISTSATPARLRQTLRLRKS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactctcttcttgccttgcccgtcaagcaaacgctgtcgccgtcgttaacactg
cgccagcaggatcagttgctgctggtggcggtggaccatccgcaggtgcgggcggcgatc
acgttgcagggggcgcatcttatcgcctggcagcccaccggcgagcaaccggtgctatgg
ttaagcgagaaaagcgcttttcaggaaggcctggctatacgcggtggcgtgcccatttgc
tggccctggtttggcaagatcgctaccccgaatcatggcttcgcccgtattctaccgtgg
gaactgagcgatcacagcgaggacggccaacaggtacaactgacctttaccctgcgcgat
agcaccctgaccgaaccctttttcccccacccgttcacgcttaaagcccattttacgctc
gggcagacctgcagtatcgaactggtggccgagggtgagtatcaggcaacggccgcgctg
cacagctatttcaccgtgggagccatcggcgatatccacgtcagcggcctcggcgccaac
tttatcgataaggtcaacggcgccttgcctgcccagcaacagggagatttgaccttttcc
ggcgaagtggaccgcgtttacaccgcgccggcggaaaccagcctgattcatgatccggtg
ctggggcgggtgattgaagtccaccatcagcatcatagcgacgtcgtgtcctggaactgt
gggcaatcgctgtcgcaatcgatcggcgatttggctgatgacagttacctgagctatgtg
tgtgtggagacggcgcgggtcaatgcaccgcttatcagcacctccgccacgccggcgcgc
ttaaggcaaacgctgcgtctgcgtaagtcctga

DBGET integrated database retrieval system