KEGG   Sodalis glossinidius (Glossina spp.): SG1367Help
Entry
SG1367            CDS       T00316                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SG1367
   00052 Galactose metabolism
    SG1367
   00500 Starch and sucrose metabolism
    SG1367
   00520 Amino sugar and nucleotide sugar metabolism
    SG1367
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SG1367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2268920..2269822
Genome map
AA seq 300 aa AA seqDB search
MSAITTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLAEIQAICPPYVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESNLKTENLAAMLKRFEDTGRSQILVEPVEDVTSYGV
VDCQGKTLNPGESVEMVGVVEKPSAEEAPSNLSVVGRYVLSAYIWALLEKTPPGAGNEIQ
LTDAIAMLMDKESVEAYHLMGLNHDCGNKLGYMQAFVEYGLRHESLGKEFKTWLKDAITQ
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctattacgaccaaagtgaaaaaagcagtaatcccggtggcgggactgggtaca
cgaatgttgccggcaaccaaagctatcccgaaggaaatgcttcccctggtggataagcct
ctgattcagtatgtggtgaatgaatgtatcgccgcgggcatcaatgagattatcctggtg
acccactcctccaaaaattccattgaaaaccatttcgataccagctttgagctggaagcc
atgctggaaaaacgcgtcaagcggcagctgttggcggagattcaggcgatttgcccgccg
tatgtcaccatcatgcaggttcgtcaggggctggccaaagggctggggcacgcggtattg
tgcgcgcatccgctggtgggtgacgagccggttgcggtgattttgcccgacgtgattatc
gatgaatatgaatcaaacctgaagaccgagaatttggcggcgatgctaaaacgctttgaa
gatactggccgtagccagattctggtcgagcccgtggaagatgtcaccagctacggcgtg
gtcgattgccagggtaaaactcttaacccgggcgaaagcgtagagatggtaggcgtggtt
gaaaaaccgtctgcggaagaagcgccgtcgaatttgtccgtggtgggccgctatgtcctt
tccgcctatatctgggcgctgttggaaaaaaccccgccgggagccggtaatgaaatccag
ctgaccgatgccattgcgatgctgatggataaagaaagcgtagaagcctaccacctgatg
gggctgaaccatgactgcggcaacaaattgggttatatgcaggcgttcgtggaatacggc
ctgcgtcatgaaagtcttggcaaagagttcaaaacgtggttaaaagacgccattacacaa
taa

DBGET integrated database retrieval system