KEGG   Sodalis glossinidius (Glossina spp.): SG1372Help
Entry
SG1372            CDS       T00316                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SG1372
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG1372
   00620 Pyruvate metabolism
    SG1372
   00650 Butanoate metabolism
    SG1372
  Lipid metabolism
   00071 Fatty acid degradation
    SG1372
  Amino acid metabolism
   00350 Tyrosine metabolism
    SG1372
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SG1372
   00626 Naphthalene degradation
    SG1372
Enzymes [BR:sgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SG1372
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SG1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2275564..2278281)
Genome map
AA seq 905 aa AA seqDB search
MAVTNVAELNTLVAQVRKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILAEDDTFGTISIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNATNKAADIVLQAAIAAGAPRDIIGWIDEPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSVVVVDALYDQVRERFASHGGCMLRGQELKAVSDIILKNGGLNAAIVGQP
AAKIAEMAGLLVPGNTKVLIGEVSKVDESEPFAHEKLSPTLAMYRARDFEDAVDIAEKLV
AMGGIGHTSCLYTNQDNQGERVKFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINTKTVAKRAENMMWHKLPKSIYFRRGSLPIALEEVASDGAK
RAFIVTDRYLFNNRYADQITSVLKKHGIETEVFFEVEADPTLSIVRKGAMQMNSFKPDTI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALVPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSIMATEFSDGQALQALKLLKEYLPASYHDGTKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLVSNVIRYNANDNPTKQAAFSQYDRPQARRRYAEIAD
HLGLSAAGDRTAQKIEKLLQWLDEIKLELGIPTSIRKAGVQEADFLAKVDKLSEDAFDDQ
CTSANPRYPLIAELKQILLDTYYGRKFVEPFDNAVEAATAPAPVGDVKASVQAPKSEKKA
EKVTS
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaactcaataccttagttgcacaggtgagaaaagcacag
cgcgaatacgccaattttacccaggagcaggtggacaagattttccgcgcggccgccctg
gccgcggcagatgcccgtatccccctagccaaaatggcggtagccgaatccggcatgggt
atcgtggaagacaaagtcatcaagaaccactttgcttctgaatacatatacaacgcctac
aaagatgaaaaaacctgcggcatcctggccgaggatgacacctttggtaccatctccatc
gctgagccgattggccttatctgcggtatcgtgcccacgaccaaccccacgtctaccgcc
atcttcaaagcgcttattagcctgaaaacccgaaacgggattatcttctcgccgcatcct
cgcgccaagaacgccaccaacaaagcggccgatattgtgctacaggccgctatcgccgcc
ggcgcgccgcgggacattatcggctggatcgacgagccgtcggtggagctgtccaatcaa
ttaatgcatcatcctgatatcaacctgatcctcgccaccggcgggccaggcatggtgaaa
gccgcttacagttccggtaaacccgccatcggcgtcggcgccggcaacaccccggtcgtg
gtggatgaaaccgcggatatcaaacgcgtggtcgcctccattctgatgtcgaaaaccttc
gataacggtgtcatttgcgcctcagaacaatccgtggtcgttgttgatgcgctgtatgat
caggtgcgtgaacgtttcgccagccacggcggttgcatgttgcgcggccaggaactgaaa
gcggtttcagatatcatcctgaaaaatggcggcctgaatgcggccattgtcggccagcca
gcagcgaagatcgccgaaatggccggcctgctcgttcccggcaatactaaagtcctgatt
ggcgaagtcagcaaagtggacgagtctgaaccctttgcacacgaaaaactgtcgccgacc
ctggcgatgtatcgcgcacgggatttcgaggacgctgtggacatcgcagaaaaattggtg
gccatgggcggcatcggtcatacctcctgtctctataccaatcaggacaaccagggcgaa
cgcgtcaagttctttggcgacaagatgaaaaccgcgcgtattcttatcaataccccggct
tcacagggcggcatcggcgatctgtataacttcaagctggcgccgtcgctgacgctagga
tgtggttcctggggcggcaactcgatttctgaaaacgttggccccaaacacctcatcaat
accaaaaccgtcgctaagcgagctgaaaatatgatgtggcataagcttcccaaatccatc
tatttccgtcgcggttccctgccgattgcgcttgaagaagtggccagcgacggcgccaaa
cgcgccttcatcgtcaccgaccgttacctgttcaataatcgctacgccgatcagataacc
tcggtgctgaaaaaacacggtatcgaaaccgaagtcttctttgaagttgaagcggatccg
accttaagcatcgtgcgtaaaggcgcgatgcaaatgaactccttcaagccggacaccatc
atcgccctgggcggtggttcgccgatggatgccgccaaaatcatgtgggtgatgtatgaa
catcctgaaacccattttgaagagctggcgctacgctttatggatatccgtaaacgtatt
tacaagttcccgaaaatgggagtgaaggcgaagatgatcgccattaccaccacctccggt
accggttctgaagtcaccccgttcgcggtagtaaccgacgatgccaccggtcagaaatac
ccgctggcggactatgctctggtaccggatatggcaattgtcgacgccaatctggtgatg
aacatgccgaaatccctgtgcgcctttggcgggctggatgcggtgacccacgcgctggaa
gcctatgtttccattatggcgaccgagttctccgacggccaggccctgcaggcgttgaaa
ttgttgaaagagtatctgcccgccagctaccacgatggcaccaaaaacccggttgcgcgt
gaacgcgtgcacaatgcggcgaccattgccggtatcgccttcgccaacgccttccttggg
gtatgtcactccatggcccataaactgggctcggaattccacattcctcatggcctggcc
aatgccatgctggtaagcaacgtcattcgctacaacgccaacgacaatccgaccaaacag
gcggccttcagccagtacgaccgcccgcaggcccgtcgtcgctacgctgaaatcgcggat
catctgggactcagcgccgcgggcgaccgcaccgcgcagaagattgaaaagctgctgcag
tggctggatgagatcaagctggagctgggtatcccgacctccatccgtaaggccggagtg
caggaggcggacttcctggccaaagtggataaactgtcggaagacgccttcgacgatcag
tgtaccagtgccaacccgcgctatccgctgattgccgaattgaagcaaattctgctggat
acttactacggccgcaagtttgtcgaaccctttgacaatgccgtagaggctgccaccgca
cctgccccggtcggggacgttaaagcgagcgttcaggcgcccaaaagcgaaaagaaagcc
gagaaagtgaccagttga

DBGET integrated database retrieval system