KEGG   Sodalis glossinidius: SG1387Help
Entry
SG1387            CDS       T00316                                 

Definition
phage lysozyme lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sgl  Sodalis glossinidius
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2301717..2302202
Genome map
AA seq 161 aa AA seqDB search
MNPELRNRLIKGTAGGVIALATVLIQWHESVHYTPYRDSGGVLSVCYGHTGSDIVPGKRY
TVAECQALLDSDLKAAMSVVDANVTVPLTESQRAALASFVYNVGNGAFARSTLLKKLNAG
DMAGACDEMRRWKYVGGKVSKGLVSRRAVEREFCTEASVIL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgagctgcgtaaccgattgataaaaggcacagcaggcggtgttattgcatta
gcgaccgtgctaattcaatggcacgagagcgtacactacactccctatcgggattctggc
ggcgtattgtcggtctgttatggacataccggtagcgatattgtccccggtaagcgctat
accgttgctgaatgtcaagccctgctagatagcgacctgaaagccgcaatgtccgtcgtt
gacgccaatgttaccgtaccactgactgagagccaaagagcggcgttagcctcgttcgtc
tacaacgtggggaacggggcgtttgcgcgctctacgctactgaaaaagctgaacgccgga
gacatggccggtgcctgtgatgagatgcggcgctggaaatatgttggcggcaaggtctcg
aagggactggtcagtcggcgggcagtagagcgcgagttttgtactgaagcctctgtcatt
ctttaa

DBGET integrated database retrieval system