KEGG   Sodalis glossinidius (Glossina spp.): SG1397Help
Entry
SG1397            CDS       T00316                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SG1397 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SG1397 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SG1397 (trpA)
Enzymes [BR:sgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SG1397 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2321032..2321838)
Genome map
AA seq 268 aa AA seqDB search
MERYQQLFSQLAARHEGAFVPFVTLGDPNPTLSLRIIDTLIDAGADALELGIPFSDPLAD
GPTIQNANLRAFSSGVTPAHCFEMLATIRQKYPAIPIGLLMYANLVYNEGIDAFYAHCAE
VGIDSVLVADVPLQESLPFRQAALRHNVAPIVICPPNSDDALLREIASHGRGYTYLLARA
GVTGSEKRANTPLKHLIDTLKEYHAAPTLQGFGISEPGQVRTALHAGTAGAISGSAIVRI
IEKHEDNPAVMLEQLAQFVRELKAATRG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctatcagcaattattcagccagctggcggcgcgccatgaaggcgcatttgtg
ccttttgtgacgcttggcgatcccaaccccacactctcgctacgcatcatcgatacactc
attgacgccggcgccgatgcactggagctgggcatcccgttctccgacccgctggccgac
ggccccaccatccagaacgccaatctgcgcgcgttttcctccggcgttacgccggcgcac
tgttttgaaatgctggcaacaattcgccaaaagtatcccgccataccgattggtctgttg
atgtatgccaatctggtctacaacgaggggatagatgccttttacgcccactgcgccgag
gtcggcatcgactcggtgctggtggcggatgtgccgctgcaagaaagtctgccatttcgc
caggccgccctgcgccataacgtggcccctattgtcatctgcccgcccaactctgatgat
gctttgctgcgcgaaatcgcctcgcacggacggggatatacctatctgctcgcgcgcgcc
ggcgttaccggcagcgagaaacgcgcaaacaccccgctcaagcatctaatcgataccctg
aaggaataccatgccgcaccgacattacagggattcggcatctccgaacccggtcaggtc
cgtaccgcgctacatgccggcacggccggcgctatttccggctcggcgattgtgcgtatt
atcgaaaagcatgaggataatccggccgtgatgttggaacagctggcccaatttgtgcgt
gaactcaaggcagcgacccgcggctga

DBGET integrated database retrieval system