KEGG   Sodalis glossinidius (Glossina spp.): SG1399Help
Entry
SG1399            CDS       T00316                                 

Definition
(GenBank) anthranilate isomerase TrpCF
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SG1399
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SG1399
Enzymes [BR:sgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SG1399
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SG1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2323062..2324420)
Genome map
AA seq 452 aa AA seqDB search
MQDTVLAKIVADKYEWVAEHQRLRPLDSFRHQVQPSTRSFYHALSGTRTAFILECKKASP
SKGLIRDDFNPVAIAGVYRHYASAISVLTDEKYFQGSFDYLREVSRSVSQPVLCKDFIVD
PWQIYFARLHQADAVLLMLSVLDDDTYRALAAVAHSLNMGVLTEVTSDEERERAIALGAK
IVGINNRDLRDLSIDLNRTRTLGPRLPAGVTVISESGINRYRQVSELSHYANCFLIGSAL
MSEPDLTMAVHRVLLGENKVCGLTRAVDARAALEAGAIYGGLIFVPGSPRCVDIDTARTV
MAGAALRYVGVFRDAQVEDVAATASVLSLAAVQLHGDEDQSYIDALRRALPPECRIWKAL
DMRQALPARDLSQVDRYVLDNGGGSGKPFDWSLLNGATLDNVMLAGGLAADNCVAAARLG
CAGLDFNSGVESAPGIKDHHKLATVFQTLSAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacacggtacttgcgaaaatcgtcgcagataaatatgaatgggttgccgagcac
caacggctgaggccgttggacagtttccgccatcaggttcagcccagcacccggagtttt
tatcacgcgctgtccggtacccgcacggcatttatactggaatgcaaaaaggcatcgccg
tccaaaggacttattcgcgatgatttcaacccggtcgccatcgcaggcgtttacaggcat
tacgcttccgcgatttcagtactgaccgacgagaaatattttcaaggcagcttcgattat
ctgcgcgaagtgagccgctcggtgagccagccggtattatgcaaagattttattgtcgac
ccctggcagatttacttcgcgcgcctgcatcaggcggacgctgttctgctgatgttgtcc
gtcctcgacgacgatacctaccgcgcgttggcggcggtggcccacagcctgaatatgggc
gtgttgacagaagtcaccagcgatgaagagcgcgagcgcgccattgcgctgggcgcaaaa
atcgtgggcatcaacaaccgcgacctgcgcgatctgtcgattgatttgaaccgcacccgc
acgctcggtccgcggctgccggcgggcgtgacggttatcagcgaatccggtattaaccgc
tatcgccaagtgagcgagctcagccactacgccaactgcttcctgattggcagcgcgcta
atgtctgaacccgatctgacgatggcggtgcatcgggtcttgctgggcgaaaacaaagtg
tgcggacttacccgcgccgtcgatgcgcgcgctgctctggaagcgggcgcgatttacggc
gggctgatttttgtccccggctccccgcggtgtgtggatatcgacaccgcccgcaccgtg
atggccggcgctgcgctgcgctatgtcggcgtgtttcgcgatgcgcaggtggaagacgtc
gctgcgaccgccagcgtgctgtcgctggcggcagtccaactgcacggcgacgaagatcag
agctatatcgatgcgctgcgccgcgccctgccgcccgagtgccgtatctggaaggcgctg
gatatgcgccaggccctgccggcgcgcgatctgagccaggtcgatcgctacgtactggac
aacggcggcggcagcggcaaacctttcgactggtcgctgttaaacggagccacgttggat
aacgtcatgctggcgggcggcctggcggcggacaactgcgtggcggcagcccgtctcggt
tgcgccggactggacttcaactccggcgtggaaagcgcgccgggtattaaagatcatcat
aaactggctacggtatttcagacgctgagcgcctattaa

DBGET integrated database retrieval system