KEGG   Sodalis glossinidius (Glossina spp.): SG1399Help
Entry
SG1399            CDS       T00316                                 

Gene name
trpC, trpF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SG1399 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SG1399 (trpC)
Enzymes [BR:sgl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SG1399 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SG1399 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2323062..2324420)
Genome map
AA seq 452 aa AA seqDB search
MQDTVLAKIVADKYEWVAEHQRLRPLDSFRHQVQPSTRSFYHALSGTRTAFILECKKASP
SKGLIRDDFNPVAIAGVYRHYASAISVLTDEKYFQGSFDYLREVSRSVSQPVLCKDFIVD
PWQIYFARLHQADAVLLMLSVLDDDTYRALAAVAHSLNMGVLTEVTSDEERERAIALGAK
IVGINNRDLRDLSIDLNRTRTLGPRLPAGVTVISESGINRYRQVSELSHYANCFLIGSAL
MSEPDLTMAVHRVLLGENKVCGLTRAVDARAALEAGAIYGGLIFVPGSPRCVDIDTARTV
MAGAALRYVGVFRDAQVEDVAATASVLSLAAVQLHGDEDQSYIDALRRALPPECRIWKAL
DMRQALPARDLSQVDRYVLDNGGGSGKPFDWSLLNGATLDNVMLAGGLAADNCVAAARLG
CAGLDFNSGVESAPGIKDHHKLATVFQTLSAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacacggtacttgcgaaaatcgtcgcagataaatatgaatgggttgccgagcac
caacggctgaggccgttggacagtttccgccatcaggttcagcccagcacccggagtttt
tatcacgcgctgtccggtacccgcacggcatttatactggaatgcaaaaaggcatcgccg
tccaaaggacttattcgcgatgatttcaacccggtcgccatcgcaggcgtttacaggcat
tacgcttccgcgatttcagtactgaccgacgagaaatattttcaaggcagcttcgattat
ctgcgcgaagtgagccgctcggtgagccagccggtattatgcaaagattttattgtcgac
ccctggcagatttacttcgcgcgcctgcatcaggcggacgctgttctgctgatgttgtcc
gtcctcgacgacgatacctaccgcgcgttggcggcggtggcccacagcctgaatatgggc
gtgttgacagaagtcaccagcgatgaagagcgcgagcgcgccattgcgctgggcgcaaaa
atcgtgggcatcaacaaccgcgacctgcgcgatctgtcgattgatttgaaccgcacccgc
acgctcggtccgcggctgccggcgggcgtgacggttatcagcgaatccggtattaaccgc
tatcgccaagtgagcgagctcagccactacgccaactgcttcctgattggcagcgcgcta
atgtctgaacccgatctgacgatggcggtgcatcgggtcttgctgggcgaaaacaaagtg
tgcggacttacccgcgccgtcgatgcgcgcgctgctctggaagcgggcgcgatttacggc
gggctgatttttgtccccggctccccgcggtgtgtggatatcgacaccgcccgcaccgtg
atggccggcgctgcgctgcgctatgtcggcgtgtttcgcgatgcgcaggtggaagacgtc
gctgcgaccgccagcgtgctgtcgctggcggcagtccaactgcacggcgacgaagatcag
agctatatcgatgcgctgcgccgcgccctgccgcccgagtgccgtatctggaaggcgctg
gatatgcgccaggccctgccggcgcgcgatctgagccaggtcgatcgctacgtactggac
aacggcggcggcagcggcaaacctttcgactggtcgctgttaaacggagccacgttggat
aacgtcatgctggcgggcggcctggcggcggacaactgcgtggcggcagcccgtctcggt
tgcgccggactggacttcaactccggcgtggaaagcgcgccgggtattaaagatcatcat
aaactggctacggtatttcagacgctgagcgcctattaa

DBGET integrated database retrieval system