KEGG   Sodalis glossinidius: SG1529Help
Entry
SG1529            CDS       T00316                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sgl  Sodalis glossinidius
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sgl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2590366..2591340)
Genome map
AA seq 324 aa AA seqDB search
MSSVYPVSRPRRLRRTPALRALFQETEVRLSDLVLPIFVEEEVSDYVPVSVMPGVVRIPE
ARLAFEIERYAKAGIQSVMTFGISHHLDDTGSDTWQENGLVARMARICKDTAPEMIVMSD
TCFCEYTTHGHCGVVHDNGVDNDATLVNLGRQAVAAARAGADFIAPSAAMDGQVQAIRAA
LDGAGFTDTAVMAYSTKFASAFYGPFREAGGTALKGNRKTYQMNPMNRREAIRESLLDEQ
EGADALMVKPAGAFLDTIRDIREAAHLPLAAYQVSGEYAMIKFAAAAGAIDERQIVRETL
GAIKRAGADIILSYFTLDIAEQGF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgtttatcccgtttcacgtccacgccgtttgcgccgtacccctgctttgcgc
gctctgttccaggaaaccgaggtacggctaagcgatctggtactgccgatattcgtcgag
gaggaggtcagcgactatgtgccggtgtccgtcatgccgggcgtggtcaggataccggaa
gcacgcctggcttttgaaatcgagcgctatgccaaagccggcattcaatctgtcatgacc
ttcggcatttcccatcacctggacgatacaggtagcgatacctggcaggagaatggcttg
gtcgcgcgcatggcgcgcatttgtaaagacacggcgccggaaatgattgtcatgtccgac
acctgcttttgcgaatataccacccacggtcattgcggcgtggtgcacgataacggggtc
gacaatgacgccacacttgtgaatttggggcgtcaggcggtagcggcagcgcgcgccggt
gcggattttattgccccgtcggcggcgatggacgggcaggtgcaggcgatacgcgccgcg
ctggacggcgccggcttcaccgacaccgccgtgatggcgtattccaccaagtttgcctcg
gccttttatggtccgtttcgcgaagccgggggcactgccctgaagggtaaccgcaaaacc
tatcaaatgaacccgatgaaccgccgcgaagcgatacgggagtcgctgttggatgagcag
gagggggccgatgcactgatggtaaagccggccggcgcttttttggacaccatccgcgat
atccgcgaggcggcccatttgccgctggcggcgtatcaagtaagcggcgaatacgcgatg
atcaaatttgccgctgccgccggcgccattgacgaacgccaaatcgtgcgcgaaaccctg
ggcgcaatcaagcgtgccggggcggatattattctcagctatttcaccctggatattgcc
gaacagggtttttaa

DBGET integrated database retrieval system