KEGG   Sodalis glossinidius (Glossina spp.): SG1559Help
Entry
SG1559            CDS       T00316                                 

Definition
phage lysozyme lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Brite
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SG1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2660232..2660717)
Genome map
AA seq 161 aa AA seqDB search
MNPELRNRLIKGTAGGVIALATVLIQWHESVHYTPYRDSGGVLSVCYGHTGSDIVPGKRY
TVAECQALLDSDLKAAMSVVDANVTVPLTESQRAALASFVYNVGNGAFARSTLLKKLNAG
DMAGACDEMRRWKYVGGKVSKGLVNRRAIEQELLCKVMINI
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgagctgcgtaaccgattgataaaaggcacagcaggcggtgttattgcatta
gcgaccgtgctaattcaatggcacgagagcgtacactacactccctatcgggattctggc
ggcgtattgtcggtctgttatggacataccggtagcgatattgtccccggtaagcgctat
accgttgctgaatgtcaagccctgctagatagcgacctgaaagccgcaatgtccgtcgtt
gacgccaatgttaccgtaccactgactgagagccaaagagcggcgttagcctcgttcgtc
tacaacgtggggaacggggcgtttgcgcgctctacgctactgaaaaagctgaacgccgga
gacatggccggtgcctgtgatgagatgcggcgctggaaatatgttggcggcaaagtatcg
aagggactggtcaatcggcgggcaatagagcaagagttgttgtgtaaggtaatgataaat
atttaa

DBGET integrated database retrieval system