KEGG   Sodalis glossinidius: SG1681Help
Entry
SG1681            CDS       T00316                                 

Definition
phage lysozyme lysis protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sgl  Sodalis glossinidius
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2876237..2876764)
Genome map
AA seq 175 aa AA seqDB search
MASKSKLSAAMLALIAAGATSTVMMSQFQDEKEGLRTAAYQDGGGVWTICGGTTFVNGKP
VVQGMRLSVDQCERIDKVEQAKALAWVERNVRVPLTETQKVGIASFCPWSIGPAKCFSST
FWKKLNAGDRSGACAEIRRWIWDGGRDCRIRSNNCYGQVLRREQEAELTCWGLDE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaaaagtaaactcagtgcggccatgttggcgttaatcgctgccggtgcgacg
agcacggtaatgatgtcgcagtttcaggatgaaaaagaagggctacggacagcggcatac
caggacgggggcggtgtctggactatctgtggcggcactaccttcgttaacggtaagccg
gtagttcaagggatgcggttgtctgtagaccaatgcgagagaattgataaggtcgagcag
gctaaagcattggcttgggttgagcggaatgtgcgtgtgcctctgaccgagacgcaaaaa
gtgggcattgcctcattctgtccgtggagcataggcccggctaagtgcttttcgtccacg
ttctggaaaaagctcaacgccggggatcgcagtggtgcctgtgccgaaatcaggcgctgg
atttgggatggtggtcgagattgccgtatccgttcaaataactgctacggtcaggtgctg
cggcgtgaacaggaagcagagctgacatgctggggacttgatgaatga

DBGET integrated database retrieval system