KEGG   Sodalis glossinidius: SG1718Help
Entry
SG1718            CDS       T00316                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sgl  Sodalis glossinidius
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sgl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2933308..2934435
Genome map
AA seq 375 aa AA seqDB search
MPCPVLELTQQLIKRPSLSPDDAGCQALIAARLQALGFTIEQMSFGDTLNFWAWRGQGST
LAFAGHTDVVPAGDLQLWDNPPFEPTLCDGMLYGRGAADMKGSLAAMVVAAERFVAQHPQ
HEGRLAFLITSDEEADAQDGTVKVVDALMARQERLDYCLVGEPSSSRQVGDIVKNGRRGS
LTANLVVQGVQGHVAYPHLADNPFHRAMAALKELVETQWDEGNSFFPPTTMQIANIHAGT
GSNNVIPGELLVQFNFRFSTELTDVIIRQRVEALLQHHGLRYRIDWSLSGQPFLTARGEL
VDAAVRAVEHYQELTPRLETTGGTSDGRFIARLGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQRIMEQLIL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccttgtcccgtactagaactcacgcaacagttgatcaaacggccctccctaagcccc
gacgacgccggctgccaggcactcattgcggctcgcctgcaggcgctgggtttcaccatt
gaacagatgtcgttcggcgatacgctgaatttttgggcctggcgcggacagggcagtacg
ctggcctttgccggccataccgatgttgtgccggccggtgatcttcagctttgggataac
ccgccgttcgagccaacgctttgcgacggcatgctttacggccgcggcgctgccgatatg
aaaggctcgctggccgccatggttgtcgccgccgaacgttttgtcgcccagcatccgcag
catgagggccggctggcgttcctgattacctccgatgaggaagccgacgctcaggatggc
accgtcaaagtggtagacgcgctgatggcgcgtcaggaacggctggattattgcctggta
ggcgagccgtccagcagccgtcaggttggggatatcgtcaaaaacggtcgacgcggctcg
ctgaccgccaatctggtcgtgcagggcgtacagggccacgtcgcctatccgcatctggcg
gacaaccctttccatcgcgcgatggcagcgctgaaagaattggtggaaacccaatgggat
gagggcaactccttttttccacccaccacgatgcaaattgccaatatccatgccgggacc
ggcagcaacaatgtcattcccggcgagctgctggtgcaattcaacttccgtttcagcacc
gagttgaccgacgtcattatccgtcagcgggtagaagcgctgttgcagcatcacgggctg
cgctaccgcattgattggtcgctttccggccagcccttcctgacggcgcgcggtgagcta
gtagacgcggcagttcgggcggtggagcattatcaggagctaacgccgcgcctggaaacc
accggcggcacttccgatggtcgcttcatcgcacgtctaggcgcgcaggtggtggaactc
ggcccggtgaacgccaccattcataaagtcaacgaatgcgtcagcgccgccgatttgcaa
ctgctgagccggatgtaccagcgcatcatggaacagttgattctatga

DBGET integrated database retrieval system