KEGG   Sodalis glossinidius (Glossina spp.): SG1953Help
Entry
SG1953            CDS       T00316                                 

Definition
glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SG1953
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SG1953
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SG1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3360985..3362937
Genome map
AA seq 650 aa AA seqDB search
MSATGKMTAPCLHPSREHMMNTIPPSHVNGVTAAAAPTSQHRTSALSQALTSADNSQSVL
TNMTLREKIGQKIMLDFRYWGRDSASGAAQDTVALNANIEHILHTYHIGGVILFANNLKK
TDQIRRLTAQLAAVPQTHGIGLMIAIDNEGGNVFRLPRGEYTAFAGNMPLGALDQGHSES
VLPYLQGKIMAQELRSLGINVNFAPVVDVNSNQANPVINVRAFSDSPARVDKLARELVKG
SAQIVTCYKHFPGHGDTHTDSHMDLPRVDRNREEAYAIDLAPYRAAIAENEAPDMIMTAH
IQYPALDDSRITRLDGEDIVVPATLSRRIQHDLLRQELGYRGVTITDALDMKAISANFDP
RDVVKRVFNAGIDIALMPVSIQAPEEEEKLRELIDYVATQVEHGEINGEEIDASVARILS
LKRAKNILAGQAPSVTIGETEQRLAKEVESAVAEQSITLLQNHQLLPLRDISSKIVIFTP
WGEQGHAVRQVLTQKGFHDVNSHKLADIAWQTQQREIDRCDIVIVGSQAVGVSPVENNGQ
AGGVAAASDTASIDAIIDYAHRQQKKIVLLLMRSPYDIIHFDGKTDAVLATYSYYGLDNG
VRRGESLFAAARALVGELQPSGKLPVNIYNVDSQGAATDIRYPRGFGLSC
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgacgggaaagatgaccgccccctgtttacacccatcgagagagcacatgatg
aacaccatccccccttcacatgtcaacggtgtcaccgccgccgctgcgccgacgagtcag
catcgcaccagcgcgctcagccaggcgctgacgtccgccgacaacagccagtccgttttg
accaacatgacgcttagagaaaaaattggtcagaaaatcatgctcgatttccgctattgg
ggccgggatagcgccagcggcgcggcacaggacaccgtggcgctcaacgcaaacatcgaa
cacattttgcatacgtaccacatcggcggtgtcattctgtttgccaacaacctgaaaaaa
accgatcagatccgtcgcctgacggcccaattagccgccgtgccccagactcacggcatc
ggtttgatgattgctatcgataacgaaggcggcaacgtctttcgtctgccgcgcggagag
tacaccgcttttgcgggcaatatgccgctcggggcgctggaccagggccacagcgaaagc
gtactcccctacctgcagggcaagatcatggcgcaggaactgcgcagcctgggcatcaac
gtcaactttgcgccggtggtggacgtcaacagcaatcaggccaatccggtgatcaacgtt
cgcgcgttcagcgattcccctgcccgggtcgataaattggcccgggaactggtgaaaggt
agtgcgcagatagtcacttgctacaagcacttccctggccatggcgatacgcataccgac
tcccacatggacttgccgagagtagaccgcaaccgggaggaggcctacgccatcgacctg
gcgccctaccgcgccgctatcgccgaaaatgaggcgccggacatgatcatgaccgcccac
attcaatacccggccctcgacgacagccgaatcacccggctcgacggcgaagacattgtt
gttcccgccaccctgtcgcgcaggatccagcacgacctgctgcgacaggagttaggctac
cgcggcgtgaccattaccgatgccttggatatgaaggccatcagcgccaacttcgacccg
cgcgacgtggtgaagcgggtgttcaacgccggtatcgatatcgctctgatgccggtcagc
atacaggcgccagaagaagaagaaaaactacgcgagctaatcgactatgtggccacgcag
gttgaacatggcgagattaacggcgaagagatcgatgcctcggttgcacggatcctgtcg
ctcaaacgggccaaaaacatcctggcaggccaggcaccctctgtcacaatcggcgaaacc
gaacagcgtttggcgaaagaagtggaaagcgctgttgccgaacaatcgatcacgctattg
caaaaccatcaattgctgcccctgcgggacatcagcagtaagatcgtcattttcacaccc
tggggcgaacagggtcatgccgtacggcaggtgttgacccaaaagggctttcacgacgtc
aacagccataagctcgctgacatcgcctggcagacacagcaacgggaaattgatcgctgc
gatatcgttatcgtcggtagccaggcggtcggcgtcagcccggtggagaacaacggccaa
gccggcggtgtggccgctgccagcgacacagcgtcgattgacgccatcatcgattatgcc
caccgtcagcagaagaaaatcgtgctgctgctgatgcgttcgccctacgacattattcac
ttcgatggcaagaccgacgctgtgctggcaacctattcctattacggtctggataacggc
gtacgccgcggcgaatcgctgtttgccgccgcacgggcgttggtgggggaattgcaaccg
agcggtaagctgccggtgaatatctataatgtcgattcgcagggagcagcaaccgatatc
cgctacccgcgcggcttcggcctgagctgctga

DBGET integrated database retrieval system