KEGG   Sodalis glossinidius (Glossina spp.): SG1972Help
Entry
SG1972            CDS       T00316                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SG1972 (recD)
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SG1972 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3399933..3401792)
Genome map
AA seq 619 aa AA seqDB search
MMEAILAEAQRLRLWRPLDVQFALMLATPAEPALMLASAWLSADAGAGHVCLPLALLTPE
RLFDGRMPPLAQQAWLQAGSPSQEDWQQRLLASPAVSDGSRPTPLVLDNQRLYLQRMWRY
ECAVAQFFNRARPPVDGEEARIAAVLARYFPGDDAVIDWQKIAAAVAITHPVALISGGPG
TGKTSTVAKLLAALLQLSDGRRLRILMAAPTGKAAARLSESLSLALQRLGLDEEQKQRLP
REAITLHRLLGAQPNSQRMRYHRGNPLHVDILIIDEASMVDLPMMANVIAALPSQARVIF
LGDRCQLSSVEAGAVLGDICQFAEAGYSPAQRAQLARLTGFTLPAGCDGYGVADSLCLLR
KSYRFDEGSGIGRLANAINAGDGKGALGLLKAGTAADVDYTPLREAADYQRLLDDCVSGY
WDYLQRVRDQDAPAAILDAFNRFRLLCALREGPFGVAGLNDRIEQALSRAGLLTLGNAGR
GYAGRPVMIVRNAPSLGLYNGDIGILLREDEQTLRVHFSLPDGGIRAVPLSRLPEHETAF
AMTVHKSQGSEFQHTALVLPNQIVPVLTRELLYTAVTRARARLSLYATDEVVQYAIATRT
QRRSGLIERLAAGAPSDVR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagctattcttgccgaggcgcaacggttgcgcctgtggcgaccgctggacgtt
caatttgccctaatgctggcgacgcccgctgagcccgcactgatgctggccagcgcctgg
cttagcgccgatgccggcgctggccatgtttgcctgccgctggcgctattgaccccggag
cggctatttgacggccgaatgccgccgctggcgcaacaggcgtggctacaagctggcagc
ccttctcaagaggattggcagcaacgtctgctggcatcgccggcggtcagcgacggttcc
cgcccgacgcctctggtattggacaatcagcgtctatatttacagcgcatgtggcgctat
gaatgcgcggtggcgcagttcttcaaccgggcgcggccgccggtggacggcgaggaagcc
agaatcgccgcggtgctggcgcgttactttcccggcgacgatgctgtaatcgactggcaa
aaaattgccgcggcggtcgcgataacgcatcctgtggcgctgatatccggcgggccgggc
accggtaaaacctctacggttgcgaagctgctggcggcattgctgcagcttagcgacggc
cggcgtttgcgcatactgatggcggcccccaccggcaaggcggcggcacggctgagtgag
tccctaagtctggcgttgcagcgtctgggattggacgaagagcaaaaacagcggttgccg
cgcgaggcgataacgctacatcgcttgctcggggcacagcccaacagccagcggatgcgc
tatcaccgcggcaacccgctgcatgtggatatcctgataatcgacgaagcgtcgatggtc
gatttgccgatgatggccaatgtcattgcggcgctgccgtcgcaggcgcgggtgattttc
ctgggggatcgttgccagctgtcgtcggtggaggcgggggcggtgttgggggatatctgc
cagttcgccgaggccggttacagccccgcgcagcgcgcgcagctggcgcggttgacgggt
tttacgctgccggcggggtgcgacggttacggcgttgccgacagtctgtgtctgctgcgt
aaaagctaccgctttgacgagggttccggcattggccggttggctaacgcgatcaacgcc
ggagacggaaagggcgctctggggctgttgaaggccggcacggcggcggacgtagactac
acgccgctgcgtgaggcggcagactatcagcgcctgctggacgactgcgttagcggttac
tgggactatctgcagcgggtacgcgatcaagatgcgccggccgctattttggacgccttt
aaccgcttccgcctgctatgtgcgctgcgtgaagggccgtttggggtcgccggccttaac
gatcgcattgaacaggccttgagccgggcggggctgctcacccttggcaacgctggccgc
ggctacgctggccggccggtgatgatcgtgcgcaatgcaccgtcgctggggctgtacaat
ggcgatatcggtattttgctccgggaggacgaacagacgctgcgcgtgcacttttccttg
ccggatggcggtatcagggcggtgccgttgagccggctgccggaacatgagacagccttt
gcgatgactgtgcataaatctcaggggtcggagttccaacatacggctctggtattaccc
aatcaaatcgtgccggtgctgacgcgggagctgctttataccgcagtgacgcgcgcgcgc
gcgcggctctctctctacgccaccgacgaggtggtgcagtacgccattgccacccgaacc
cagcggcgcagcggccttatcgagcggctggcagccggtgcgccatccgacgtccgctga

DBGET integrated database retrieval system