KEGG   Sodalis glossinidius (Glossina spp.): SG2017Help
Entry
SG2017            CDS       T00316                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SG2017
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SG2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3476570..3477493)
Genome map
AA seq 307 aa AA seqDB search
MTTLGHNYDNSLVSNAFGFLRLPLEFNPYATDADWVITGIPFDMATSGRAGCRHGPAAIR
QVSTNLAWEGCRWPWDFDVRKRLKVVDCGDLVYEFGDAQDFCDKLQDHAERLLAAGKRML
SFGGDHFVTLPLLCAHAKHFGKMALVHFDAHTDTYANGSKFDHGSMFYHAPNEGLISPAH
SVQIGIRTEFERDNGFTVLDAGQVNDRSVDDILAQVKQIVGNLPVYLTFDIDCLDPSAAP
GTGTPVIGGLTSDRALKLVRGLQPLNIVGMDIVEVAPAYDQAQITALVAATLALEMLYIQ
GAKRGDD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccctgggtcataattacgataactcgctggtatcgaatgcttttggtttcttg
cgtttgccgctggaattcaacccatatgccacggacgccgactgggtcatcaccggtatt
ccgttcgatatggccacctccggacgtgccggctgccggcacgggcccgccgcgatacgc
caggtttccaccaacctggcctgggaaggctgccgttggccatgggatttcgatgtgcgt
aagcgcttgaaagtggtcgattgcggcgatctggtgtatgagttcggcgatgcgcaggat
ttttgcgataaattgcaggaccacgccgagcggctgctggcggccggcaagcggatgctg
tcgttcggcggcgatcacttcgttaccctgccgttgctgtgcgcccacgccaagcacttt
ggcaaaatggcgctggtgcattttgacgctcacaccgatacctatgccaacggcagcaag
ttcgatcatggctccatgttttatcatgcgccaaacgaagggttaatcagccccgcgcat
tctgtgcagataggcatccgcaccgagtttgaacgcgataacggtttcaccgtgctggat
gcgggacaggttaatgaccgcagcgttgatgacatcctggcgcaggtgaagcagattgtg
ggtaacctgccggtctatttgacctttgatatcgactgtctcgatccttcggcggcgccc
ggcaccggtacgccggttatcggcggcctgaccagcgatcgggcgttaaagctggtgcgc
gggctgcaaccgttgaatatcgttggtatggatatcgtcgaggtcgcgccggcctacgat
caggcgcagattaccgcgctggtcgccgccacgctggcgctggaaatgctttacatccag
ggtgccaagcggggcgacgactga

DBGET integrated database retrieval system