KEGG   Sodalis glossinidius (Glossina spp.): SG2065Help
Entry
SG2065            CDS       T00316                                 

Definition
response regulator for chemotaxis
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SG2065
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SG2065
Enzymes [BR:sgl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SG2065
Two-component system [BR:sgl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SG2065
Bacterial motility proteins [BR:sgl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SG2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3563282..3564181)
Genome map
AA seq 299 aa AA seqDB search
MNKIRVMCVDDSAMMRQLMTEIVNSFPDMEMVATAPDPIIARDLIKRLNPAVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGRGSEITLRAVDFVTKPQLGLRDGMLQYRELIGE
KIRTAARVRLLPHRPKPSSPVILDGPLLSSEKLFAIGASTGGNEAIRQVLEPLPVTSPAL
LINQHMPAGFTCSFANRLNKHCHIAMKEAEEGERVLPGHATSPPAPAIWNWRAAVPTNVI
RLHDGLPVNRHRPSVDVLFHSVAKFAGRNTVGVILTGMGNDGAAGLRRCARRAPGRWSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaattcgagtcatgtgcgtggacgattctgccatgatgcgacagctcatgacc
gagatagtcaacagcttccccgatatggaaatggtggccaccgcgccggacccgattatc
gcccgggatttaattaagcggttgaatccggcggtgttaacgctggatgtggaaatgccg
cgtatggacggtctggatttcctggaaaaactaatgcgcctgcggccgatgccggtggtg
atggtgtcctcgctgaccggacgcgggtcggagatcacgctgcgcgcggtggatttcgtg
acgaaaccgcagttggggttgcgcgatggcatgttgcagtatcgggaacttattggcgag
aaaatccgcacggcggcccgagtccggctgctgccgcatcgcccgaagccgtcgtcgccg
gtgatcctggacggtccgctgctcagcagcgaaaagctgtttgccatcggcgcctcgacc
ggcggcaacgaggcgattcgccaggtgctggagccgttgccggtgaccagtccggcgctg
ctgattaaccaacatatgcccgctggcttcacctgttcgttcgccaatcggctaaacaaa
cattgccatattgcgatgaaagaggcggaggaaggggagcgggtattaccgggacacgct
acatcgcccccggcgcccgccatatggaactggcgcgcagcggtgccaactaatgtaatc
cggctgcacgatggactgccggttaaccgccatcgtccttcagtggacgtactgttccat
tcggtggcgaaattcgccggccgcaacaccgttggcgttattttgaccggcatgggcaac
gatggcgcggcgggcctgcggcgatgcgccaggcgggcgcctggacgctggtcaagctga

DBGET integrated database retrieval system