KEGG   Sodalis glossinidius (Glossina spp.): SG2122Help
Entry
SG2122            CDS       T00316                                 

Definition
(GenBank) acetyl-coenzyme A synthase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00010  Glycolysis / Gluconeogenesis
sgl00620  Pyruvate metabolism
sgl00640  Propanoate metabolism
sgl00680  Methane metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01130  Biosynthesis of antibiotics
sgl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2122
   00620 Pyruvate metabolism
    SG2122
   00640 Propanoate metabolism
    SG2122
  Energy metabolism
   00680 Methane metabolism
    SG2122
Enzymes [BR:sgl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SG2122
Lipid biosynthesis proteins [BR:sgl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SG2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAE75397
UniProt: Q2NR28
Position
3679871..3681829
Genome map
AA seq 652 aa AA seqDB search
MSQPHRYPIPASLAERTLVSAEQYRKLYEQSINDPDSFWREYAQIVEWITPFQTVKNTTF
DPGHVNIRWFEDGTLNVAANCLDRHLQERGDQTAIIWEGDDASQSKTLTYRQLHQAVCRF
ANVLKAQGIGKGDVVALYMPMVPEAAVAMLACARIGAVHSVIFAGFSPEAIAGRIIDSSA
KLVVTADEGLRAGRKIPLKKNIDDALNHPEVKSVNRVIVFRRTGNAIDWQPERDVWWHDA
IDGADDTCPPEAMGAEDPLFILYTSGSTGTPKGVLHTTGGYLVYAATTFKYVFDYHPGDV
YWCTADVGWVTGHSYLLYGPLACCAITLMFEGVPNWPAASRMAQVVDKHQVNILYTAPTA
IRALMAEGDKAITGTHRSSLRIMGSVGEPINPEAWEWYYHKIGNGRCPIVDTWWQTETGG
FMITPLPGAMALKPGSAALPFFGVQPALVDNVGTPVDGAGEGNLVITDSWPGQARTLYGD
HDRFKQTYFYTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTSEIESALVAHP
KIAEAAVVGMPHNIKGQAIYAYITLNAGETPTPELYNEVRAWMRKEIGAIATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTGNLGDTSTLADPGVVEKLLEEKHTLTLPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaccccatcgttacccgattcccgctagcctcgcggaacgtacgctggtttct
gcggagcaatatcggaaattgtatgagcagtccatcaacgatcccgattccttttggcgg
gaatacgcccagattgtggaatggataacccctttccagacggtgaaaaatacgaccttc
gatcctggccatgtcaatattcgctggtttgaagacggcacgctgaatgtggccgccaac
tgtctcgatcggcatttgcaggagcggggcgaccagactgccattatctgggagggggat
gacgccagtcaaagcaaaaccctgacctaccggcaattacatcaggcggtgtgccgcttc
gccaatgtcctgaaggcgcagggtatcggcaaaggggatgtggtggccctttacatgccc
atggtgccggaagccgcggtggcgatgcttgcctgcgcacgcatcggcgccgttcactcg
gtcattttcgccggtttttcgccggaggcgatcgccggccgcatcatcgattccagcgcc
aaattggtggtaaccgccgacgaggggcttcgcgctggacgcaaaatccccctgaagaaa
aacatcgacgatgcgttaaatcatccggaggtgaaaagcgtcaaccgggtcatcgtcttc
cgccgtaccggcaatgcaattgactggcaacctgagcgggatgtgtggtggcacgacgcc
atcgacggcgccgacgatacctgcccgcccgaggcgatgggggcggaagatccgctgttc
attctctatacctccggctccaccggcactcccaagggggtgctgcacactaccggcggc
tatctggtttacgccgccacgacctttaaatatgtattcgactatcaccccggcgatgtt
tattggtgtaccgctgacgtcggctgggtaacggggcacagctatctgctgtacggcccg
ctggcctgctgcgccattaccctgatgtttgagggcgtgcccaactggccagccgccagc
cgcatggcgcaggtggtggacaaacatcaggtgaatattctctacaccgcgcccaccgcc
attcgcgcgctgatggccgaaggtgacaaggcgataaccggtacgcatcgttcgtcgctg
cggatcatgggctctgtgggcgaacccatcaaccctgaagcctgggagtggtattaccat
aagatcggcaacggccgctgcccgatcgtcgatacctggtggcagaccgaaacgggcggc
ttcatgatcactccgctaccgggcgccatggcgttaaaacccggctcggcggcgctgccg
tttttcggcgtccagcccgctctggtagataacgtcggcacgcctgtcgacggcgccggg
gaaggcaatcttgtcatcaccgactcctggcccggtcaagcgcgtaccctctatggcgat
cacgatcggttcaagcagacctatttctacacctttaaaggcatgtatttcagcggcgac
ggcgcccggcgcgatgaggacggctattattggataaccggccgcgtcgatgatgtactc
aacgtttccggccaccgcctcggcacctccgagatcgaatcggctttggtggcccatccg
aaaattgccgaagcggcggtggtggggatgccgcacaacatcaaaggccaggcgatctac
gcttatattacgctcaacgcgggcgaaaccccgacgcctgagctgtataacgaagtccgc
gcctggatgcgtaaagaaatcggcgcaatcgccacccccgatgttctgcattggaccgat
tcgctgccgaaaacccgctccggcaagataatgcgccgcatcttgcgtaaaattgccgcc
ggcgacaccggcaatctcggtgacacctccacgctggccgatcctggcgtggtcgaaaaa
ctgctggaagaaaaacacactctgaccttgccttcgtaa

DBGET integrated database retrieval system