KEGG   Sodalis glossinidius: SG2131Help
Entry
SG2131            CDS       T00316                                 

Definition
aromatic amino acid aminotransferase (EC:2.6.1.57)
Orthology
K00832  
aromatic-amino-acid transaminase [EC:2.6.1.57]
Organism
sgl  Sodalis glossinidius
Pathway
Cysteine and methionine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Phenylalanine biosynthesis, chorismate => phenylalanine
Tyrosine biosynthesis, chorismate => tyrosine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgl01230]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sgl00270]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sgl00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:sgl00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sgl00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:sgl00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3700499..3701695)
Genome map
AA seq 398 aa AA seqDB search
MFRNVDAYAGDPILTLMETYKQDPRPDRVNLSIGLYYNEQAIIPQLQAVAEAQAMLLARA
TSSSSSYLPIEGLSTYRSATQALLFGEDHPMRNALRIATIQTVGGSGALKVGADFLKCYF
PDSQVWVSDPTWENHVAIFSGAGFQVNRYPYFDDEKLGVNFSAMLACFQQLPPRSIVLLH
QCCHNPTGSDLTRSEWEQIIAVVAERQLIPFLDIAYQGFGDGLEEDAFAVREMARLGLPC
MVTHSLSKIFSLYSERVGELSIVCDSASEAERVLSQLKATVRRNYSSPPNFGAQVVAQVL
NEPALNTLWREEVAAMRQRILAMRHSLVAALKVALPDHQFDYLLRQRGMFSYTGLSPAQV
ADLRDTFGVYLIDSGRMCLAGLNTANVAKVAEAFAAVQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgttccgaaatgttgatgcttatgcgggagatcctatccttacgctgatggaaacctat
aaacaggatccgcgacctgacagggtcaatttaagcatcggcctttattataatgaacag
gcgatcattccccaactgcaggccgtcgccgaggcgcaagccatgctgctcgcccgggcg
acgtcaagttcgtcgtcctatctgccgatagaaggcttgtcaacctaccgcagcgccacc
caggcgttgctatttggtgaagatcatccgatgcgcaatgcgttgcgtatcgccacgatt
cagaccgtgggcgggtcaggggcgttgaaagtcggggcggattttctcaaatgttatttc
ccggattcgcaggtctgggtcagcgacccgacctgggaaaaccatgtggcgattttttcc
ggcgccggattccaagtgaaccggtacccttatttcgatgatgagaagctgggtgttaac
ttcagcgcgatgctggcctgtttccagcaattgccgccgcgcagcattgtgttgctgcat
cagtgttgccataacccgaccggctcggacctgacacgttccgaatgggagcagattatc
gcggtggtggcagaaaggcagctcatcccctttctggatatcgcctaccaggggtttggc
gacgggttggaggaagacgcctttgcggtgcgcgaaatggcgcggctgggcctgccttgc
atggtaactcattctttatcaaagattttctctctttatagtgaacgtgtgggagagcta
tcgatagtttgcgatagcgcgagcgaagccgagcgggtgctgagtcagctgaaggcgacc
gtgcgccgcaactattccagtccgccaaactttggcgctcaggttgtggcgcaagttctg
aacgaaccggcgttgaataccctgtggcgtgaggaagtcgcggcaatgcgccagcgtatt
ctggcaatgcgccatagcctggtggcggcattgaaagtcgcgctgccggaccatcaattc
gattatctcctgcgtcagcgcggcatgttcagctacaccggtctcagcccggcgcaggtg
gcggatttgcgcgataccttcggcgtgtatttaatcgacagtggccggatgtgtctggcc
ggcctgaataccgccaatgtcgctaaagtggccgaggccttcgcggcagtgcagtaa

DBGET integrated database retrieval system