KEGG   Sodalis glossinidius (Glossina spp.): SG2172Help
Entry
SG2172            CDS       T00316                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SG2172
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SG2172
Exosome [BR:sgl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SG2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3783945..3785459
Genome map
AA seq 504 aa AA seqDB search
MPSEKKYIVALDQGTTSSRAIVLDHDANIVSVSQREFTQIYPKPGWVEHDPMEIWASQSS
TLVEVLAKADIRSDQIAGIGITNQRETAVVWDKESGKPIYNAIVWQCRRTADICEKLKRD
GLGEYVRHTTGLVIDPYFAGTKVKWILDHVEGARERAKRGELLCGTVDSWLIWKMTQRRV
HVTDYTNASRTMLFNIHELEWDDRLLDILDIPRAMLPKVRPSSEIYGQTNIGGKGGTRIP
IAGIAGDQQAALYGQLCVTPGMAKNTYGTGCFLLMNTGTEAVQSRHGLLTTIACGPRGEV
NYALEGSVFVAGAAIQWLRDEMKLINDATDSEYFASKVKDTNGVYVVPAFTGLGAPYWDP
YTRGAIFGITRGVNANHIIRATLESIAFQTRDLIESMQADSGERLKALRVDGGAVANNFL
MQFQSDILGSRVERPEVREVTALGAAYLAGLAVGFWSDLEEVRSKAVIEREFRPGIETVE
RNYRYEGWKKAVARARAWEEQDKE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagaaaaaaaatatatcgtcgcgctcgaccagggaaccaccagctcgcgcgcg
atcgtgctcgatcacgacgccaacattgtcagtgtctctcagcgggagtttacccaaatt
tatcccaagccgggctgggtggaacatgacccgatggaaatctgggccagccagagctcg
acgctggtggaagtgctggccaaggcggatatccgctccgatcaaatcgccggcatcggc
atcaccaaccagcgcgaaaccgccgtagtgtgggataaagagagcgggaaacctatctac
aacgccatcgtgtggcagtgccgccgtaccgcggacatctgcgagaagctgaaacgcgac
gggctaggagagtatgtgcgccacactacgggcttggtcatcgacccctatttcgccggg
accaaagtcaaatggatcctcgaccatgtggagggcgcccgcgagcgcgccaagcgcggc
gaattgctgtgcggcaccgtcgacagctggctcatctggaaaatgacccagagacgggtg
catgtcaccgattacaccaacgcctcgcgcactatgctgttcaacatccatgaactggaa
tgggacgaccgcctgctggatatcctcgatattccacgcgccatgttgcccaaagtgcgg
ccttcttcggaaatttatggccagaccaatataggcggcaaaggcggtacccgtattccc
atcgccggtatcgcgggcgatcagcaggcggcgctgtacggccagctgtgcgtcaccccc
ggcatggcgaagaatacctacggcaccggttgcttcttgctgatgaataccggcaccgaa
gcggtacaatcgcgccacggcctgctgaccaccatcgcctgcggaccgcgtggcgaagtg
aactacgcgctggaagggtcggtgttcgtcgccggcgccgccattcaatggctgcgcgat
gagatgaagctgattaacgacgccaccgactcggaatatttcgccagcaaggtgaaagat
accaacggcgtatacgtagtgccggcctttaccggcctcggcgctccgtattgggatcca
tacacccgcggtgccatcttcggcattacgcgcggcgtgaatgccaaccacatcatccgt
gcgacgcttgagtccatcgccttccaaacccgcgatcttatcgagtccatgcaggcggat
tccggcgagcggctgaaagcgttacgggtggatggcggcgcggtagccaataatttcctg
atgcagttccagtccgatattttggggagccgcgtcgaacggccggaggtccgggaagtc
accgcccttggcgccgcttatctggcgggcctggctgtcggcttctggagcgatctggag
gaggtgcgcagcaaagcggttatcgaacgcgagttccgccccggtattgaaaccgtggag
cgtaattatcgctatgagggctggaagaaagcggtggcgcgcgcacgggcctgggaagag
caagataaagagtaa

DBGET integrated database retrieval system