KEGG   Sodalis glossinidius (Glossina spp.): SG2176Help
Entry
SG2176            CDS       T00316                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00010  Glycolysis / Gluconeogenesis
sgl00051  Fructose and mannose metabolism
sgl00562  Inositol phosphate metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
sgl01130  Biosynthesis of antibiotics
sgl01200  Carbon metabolism
sgl01230  Biosynthesis of amino acids
Module
sgl_M00002  Glycolysis, core module involving three-carbon compounds
sgl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2176
   00051 Fructose and mannose metabolism
    SG2176
   00562 Inositol phosphate metabolism
    SG2176
Enzymes [BR:sgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SG2176
Exosome [BR:sgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SG2176
  Exosomal proteins of bladder cancer cells
   SG2176
  Exosomal proteins of melanoma cells
   SG2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAE75451
UniProt: Q2NQX4
Position
3789641..3790408
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMVNDLTAALRNELSSVVGCDVAIAPPVTYLELAKHHLGGSRIA
LGAQNVDTHLSGAYTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAEKFAVLKEAE
LIPVLCIGESEAENEAGQTEAVCARQIDAVLNSLGAKAFENTVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKHDAAIAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKQS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtgatgggtaattggaaacttaacggcagcaaacacatggttaat
gacctgaccgcagcgctgcgcaacgaactcagcagcgtcgtcggttgcgatgtcgccatc
gcgccgccggtgacctatcttgagctggcgaaacaccatcttggcggcagccggattgcg
ctgggtgcgcagaacgtcgacacccatctttcgggcgcctataccggcgaagtttctgct
gaaatgcttaaagatatcggcgcgaaatatatcatcatcgggcactccgaacgccgcacc
tatcataaggaaagcgatgagtttatcgccgaaaaattcgccgtgctgaaagaagccgaa
ttgattccggtattatgtatcggcgagagcgaagcggaaaacgaagccggccaaaccgaa
gcggtgtgcgcccgtcagattgatgcggtacttaacagtctgggcgccaaagcgttcgag
aataccgtcatcgcctatgagcccatctgggccattggtaccggtaaatccgccacgccg
gcgcaggcgcaggcggtgcataaatttatccgtgaccatatcgccaagcacgacgcggca
atcgctgagcaggttatcatccagtacgggggctcggtcaacgccgcaaatgccgctgag
ctgttcacccaaccagatatagatggcgccctggtcggcggcgcatcactgaaggctgac
gccttcgcggtgatcgttaaagccgcggcagaagcgaaacagtcctga

DBGET integrated database retrieval system