KEGG   Sodalis glossinidius (Glossina spp.): SG2176Help
Entry
SG2176            CDS       T00316                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG2176 (tpiA)
   01230 Biosynthesis of amino acids
    SG2176 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2176 (tpiA)
   00051 Fructose and mannose metabolism
    SG2176 (tpiA)
   00562 Inositol phosphate metabolism
    SG2176 (tpiA)
Enzymes [BR:sgl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SG2176 (tpiA)
Exosome [BR:sgl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SG2176 (tpiA)
  Exosomal proteins of bladder cancer cells
   SG2176 (tpiA)
  Exosomal proteins of melanoma cells
   SG2176 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3789641..3790408
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMVNDLTAALRNELSSVVGCDVAIAPPVTYLELAKHHLGGSRIA
LGAQNVDTHLSGAYTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAEKFAVLKEAE
LIPVLCIGESEAENEAGQTEAVCARQIDAVLNSLGAKAFENTVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKHDAAIAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKQS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtgatgggtaattggaaacttaacggcagcaaacacatggttaat
gacctgaccgcagcgctgcgcaacgaactcagcagcgtcgtcggttgcgatgtcgccatc
gcgccgccggtgacctatcttgagctggcgaaacaccatcttggcggcagccggattgcg
ctgggtgcgcagaacgtcgacacccatctttcgggcgcctataccggcgaagtttctgct
gaaatgcttaaagatatcggcgcgaaatatatcatcatcgggcactccgaacgccgcacc
tatcataaggaaagcgatgagtttatcgccgaaaaattcgccgtgctgaaagaagccgaa
ttgattccggtattatgtatcggcgagagcgaagcggaaaacgaagccggccaaaccgaa
gcggtgtgcgcccgtcagattgatgcggtacttaacagtctgggcgccaaagcgttcgag
aataccgtcatcgcctatgagcccatctgggccattggtaccggtaaatccgccacgccg
gcgcaggcgcaggcggtgcataaatttatccgtgaccatatcgccaagcacgacgcggca
atcgctgagcaggttatcatccagtacgggggctcggtcaacgccgcaaatgccgctgag
ctgttcacccaaccagatatagatggcgccctggtcggcggcgcatcactgaaggctgac
gccttcgcggtgatcgttaaagccgcggcagaagcgaaacagtcctga

DBGET integrated database retrieval system