KEGG   Sodalis glossinidius (Glossina spp.): SG2178Help
Entry
SG2178            CDS       T00316                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SG2178
   01230 Biosynthesis of amino acids
    SG2178
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SG2178
   00030 Pentose phosphate pathway
    SG2178
   00051 Fructose and mannose metabolism
    SG2178
   00052 Galactose metabolism
    SG2178
  Energy metabolism
   00680 Methane metabolism
    SG2178
Enzymes [BR:sgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SG2178
Protein phosphatases and associated proteins [BR:sgl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SG2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3791678..3792640)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLSEGLEVYGIYDGYLGLFQDRIAKLDRYSVSD
MINRGGTFLGSARFPEFREEGTRAIAIENMTKRGLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
AAIAGGCEFIVLPEVEFKPEDLVYEIKAGIAKGKKHAIVAITEYICNVAELAQYIEKETG
RETRATVLGHIQRGGRPVAYDRILASLMGAYSIELLLQGYGGRCVGVQNERLVHHDIVDA
IENMKRPFRSNILETAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtactgacaagcggcggtgattcaccaggaatgaatgcggcc
atccggggcgtggtacgggccgggctttccgaaggcctggaggtctacggcatttatgac
ggttacctgggcctgtttcaggatcggatagcgaaactggaccgttatagcgtttcagat
atgattaaccgcggcggcacctttcttggttctgcgcgttttccggaatttcgagaggaa
ggcacccgcgctatcgcgattgagaacatgaccaaacgtggtctggatgcgctggtggta
atcggtggcgatggttcctacatgggcgccaagcgtttgaccgaaatgggtttcccctgc
attggcctgccgggcacgattgataatgacgtggcgggcaccgattacaccattggctac
ttcaccgcgctggaaaccgtcgtcgaggccattgaccggctgcgcgatacatctacgtca
catcagcgtatttctattgttgaggtcatgggccggtattgtggcgatctgaccatggcg
gctgctattgccggcggctgtgagttcatcgtgttgcctgaagtggaattcaaaccggaa
gacctggtctacgaaatcaaggcgggtatcgctaagggtaaaaaacacgccattgtcgcg
attaccgaatacatctgtaatgttgctgagcttgcgcaatatattgaaaaagagacggga
cgggaaacccgcgccaccgtactgggtcatatccagcgcggcggtaggccggtggcttac
gaccgtattttggcctcgctcatgggtgcctattctattgaactgctgttgcagggctac
ggcggccgttgcgtcggggtgcaaaacgagcgactggtgcatcacgacatcgtcgacgcc
attgaaaatatgaaacgtcctttccgcagcaatatcctggaaacggcaaaaaaactcttc
tga

DBGET integrated database retrieval system