KEGG   Sodalis glossinidius: SG2323Help
Entry
SG2323            CDS       T00316                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sgl  Sodalis glossinidius
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SG2323
Enzymes [BR:sgl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SG2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3989891..3991576
Genome map
AA seq 561 aa AA seqDB search
MMEAITRLLRKIYPATLSQGQLDTIKGQISFTKSTPHQARKAHWDEDDVVLITYADQFME
AEKPTLDTFTTFFNHRLRNTFSLVHLLPFYPYSSDYGFSVIDYQQVNPIVGSWQQIGELN
LTTRLMFDFICNHMSAESRWVKGYLAGQQAYDDFFIALPPATASVTRPRTSPLLTPFTAQ
DGSTRYLWTTLSADQVDLNFNNPQVLIAVIGVLLHYLIQEADYIRLDAVGYLWKEVGTRC
LHLPHTHLLVKLFRAICDEVAPGTVIITETNVPHKDNISYFGNGRDKAQMVYQFPLPPLV
LHALHNSSRRALRHWAAGLEIGSGATTLFFNFLASHDGIEMNPLLGILPEAEIIRLVSDL
ESESALVSYKQNTDGTTSPYEINVTYLDAFNRREDSDETRLGRFILAHAILLEFPGVPAI
YVQSILGSRNDYEEVKAAGHNRAVNREKYPLKTIEAMLDDETSLRSRVFQALSALIRLRR
RQQAFHPDAAMEVLEWDNTLLAFYRAAGQRLLCLFNLANKTVSCTLPDGDYRLLTAEGTV
SGGPLTLAPYSFYWLETLSDR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagccataacccgcttgctgagaaagatttacccagccaccttaagccagggg
caactggataccatcaagggccaaatcagcttcaccaaatccacgccgcatcaggcgcgc
aaagcgcattgggatgaggatgatgtcgtgcttattacctatgccgaccagttcatggag
gctgaaaaacccacgcttgatacctttaccacctttttcaaccatcgcctgcgcaacacc
ttttccctggtgcatctgctaccgttctatccctactcttccgactatggcttttccgtc
atcgattatcagcaggtcaatcctatcgtcggcagttggcagcagataggcgaactcaat
ctcaccacccggctgatgttcgatttcatctgcaaccatatgtctgccgaaagccggtgg
gtgaaaggctatctggcgggccaacaggcttatgacgatttttttattgcgcttcccccc
gcgactgccagcgtgacgcgcccgcgcacatcaccgctgctgacgccttttaccgcacag
gacggcagcacccgttatttatggaccaccctcagcgccgatcaggtggatctcaatttc
aacaacccccaggttttgatcgccgttatcggcgtattgctacattacctgatacaggag
gcggactatatccgtctggacgcggtgggctacttgtggaaagaggtgggcacccgttgt
ctccatctaccccatacccatctgctggtaaagttgtttcgcgccatctgcgatgaggtg
gcgccgggaacggtgattattaccgaaaccaacgtgccccataaggacaatatcagctat
ttcggcaatggccgagataaagcgcagatggtctatcagttcccgcttccgccgctggtg
ttacacgccctgcacaacagcagccgccgcgccctgcgtcattgggctgcagggcttgag
atcggtagcggtgctactacattattcttcaattttctcgcctcccatgatgggatcgag
atgaacccgctgctcggcattctgccggaggcggagatcatccggctggtgagcgatctg
gagtcggaaagcgccctggtttcgtataaacaaaacactgacggtaccaccagcccttat
gaaatcaatgtcacctatctggatgcgttcaatcggcgcgaggatagtgacgagacgcgg
cttggccgctttattctcgcccatgccatcctgctggagtttcccggcgtgccggcgatc
tatgtgcaaagtatccttgggtcgcgtaatgactatgaagaggtcaaggccgccggccat
aaccgcgcggttaatcgagagaagtacccgctgaaaaccattgaagcgatgctggatgat
gaaaccagcctgcgctcgcgggttttccaggcgttgagcgcgcttattcgcctgcgccgc
cgacaacaggcgtttcatcctgatgcagccatggaagtcctggagtgggataataccctg
ctcgctttttaccgcgccgccggccagcggctgctgtgtctctttaatttggcgaataaa
acggtaagttgcaccttacctgacggcgattatcgcctgctgaccgccgagggtacggtc
agcggcggcccactaaccctcgcaccctattctttctattggctggaaacgcttagcgat
cgttag

DBGET integrated database retrieval system