KEGG   Sodalis glossinidius (Glossina spp.): SG2367Help
Entry
SG2367            CDS       T00316                                 

Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sgl  Sodalis glossinidius (Glossina spp.)
Pathway
sgl00860  Porphyrin and chlorophyll metabolism
sgl01100  Metabolic pathways
sgl01110  Biosynthesis of secondary metabolites
sgl01120  Microbial metabolism in diverse environments
Module
sgl_M00121  Heme biosynthesis, glutamate => heme
sgl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sgl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SG2367
Enzymes [BR:sgl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SG2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: BAE75642
UniProt: Q2NQD3
Position
4064673..4065413
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEQLVNRLRARGKSAWHLPLIEFTPGNDLPQLAQRLADLSAGDLLFIVS
QHAINYAHPWLTQQGVTWPAGLQYFAVGRTTGLRLHGLCGLPVSYPDEGETSEDLLRLPA
LARIEGKRALILRGNGGREVLEQTLRQRGVHTTYCECYRRSPIHYNGEEQGRRVQTLSID
TLVITSGEMLQQFYTLMPEYYRHAWLMHCRLIVISERLAILARQLGWTDIVVANAADNDA
LMRVLL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcctcgtcacccgcccatcgcccgcgggcgaacagctggtgaacaggctgcgc
gcacgcggcaaatccgcctggcatctgccgcttatcgaatttactccgggcaacgatctg
ccgcaactcgcccagcgcctcgccgatctgagtgcgggggatttgctgtttatcgtctcc
caacatgcaattaattacgcccatccctggctgacgcaacaaggcgtcacctggcctgcc
gggctacagtattttgccgtaggccgcactaccggcctacggctgcacggtctatgcggg
ctgccggtcagctatcccgatgagggggaaaccagcgaggatttgctgcgcctgccggcg
cttgcgcgcatcgagggcaagcgcgccctgatcttacgcggtaacggcgggcgggaagtg
ctggagcaaacgttgcgccagcgcggcgtgcacaccacctattgcgaatgctaccgccgc
agcccgatccactacaacggcgaagaacagggccggcgggtgcaaacgctgagcatcgac
acgctggtaattaccagcggcgaaatgttacaacaattctatactttaatgcctgaatac
tatcgccacgcctggctgatgcactgccggctgatagtcatcagcgaacgtttagccata
cttgcccgccaattgggctggacggatatcgtcgtagcgaacgcggccgacaacgatgct
ttgatgcgcgtattgctctaa

DBGET integrated database retrieval system