KEGG   Saprospira grandis: SGRA_0894Help
Entry
SGRA_0894         CDS       T01764                                 

Gene name
phoD
Definition
phosphodiesterase I (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sgn  Saprospira grandis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgn00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sgn00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sgn02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909118..910386
Genome map
AA seq 422 aa AA seqDB search
MRTSFSPAFFCLFSLLFFSLSLFGQEQLLDYKVISGPMPGHYTDSTASFWILVQKKPVLQ
KKNRLAHVLKELEQEFSSISYQDEPLWKNKRIVRVLAQKKPAITPQKDSFSFLTGSCAFQ
YPLVLNMFGKRRRYNKIFNKMAQTDADFMVWTGDNVYYVLGQWNSYKGMVKKNLRSRERK
PINKFLQSCPQYATWDDHDYGPNNSDANFPLKDTALNVFKKMWANPYYGEEDNPGVYSHF
SQENCDFFLLDSRYYCIGDGPEEKRTLFGKKQMDWLKRQLKKAKGDFKFIFSGTQLWPKL
DKGDHWDEFPAERQDFLDFLQKEDIKGVVVISGDRHYSELNCLKREADYPLYEYTCSPLT
SFTDPYYSKENDCREEGTFVRKQNYGLLTILGQGLQRICRIQTFNRKGKLLWQREIALKD
LQ
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacctctttttctcctgcctttttctgccttttctctctccttttttttagtctc
tccctctttggccaagaacaactcctagattataaagtgattagtgggcctatgcctggc
cactataccgattctaccgctagcttctggatattggtccagaaaaaacccgttttacaa
aagaaaaaccgcctagctcatgtcctcaaagaattagaacaagaatttagtagcattagt
tatcaggatgagcccctttggaaaaataagcggatagtgcgggttttggcccaaaaaaaa
ccagccattactccccaaaaagatagctttagctttctaacgggctcttgtgccttccaa
tatcccttagtcctcaatatgtttggcaaacgccgaagatataacaagatatttaataaa
atggcccaaacagatgccgactttatggtctggaccggcgataatgtctattatgttctt
ggccaatggaactcctataaggggatggtcaaaaaaaatctgcgatctagagaacgcaag
cccattaataagtttttgcaatcttgtccccaatacgctacttgggacgaccacgattat
ggccccaataatagcgatgccaatttcccgctaaaagataccgccttaaatgtctttaaa
aagatgtgggccaatccctactatggcgaagaagacaacccaggcgtttatagccacttt
agccaagaaaactgcgactttttcttgctcgattctcgctactattgtattggcgatggc
cccgaagagaaacgaacgctttttggtaaaaaacaaatggattggctcaaaagacaactc
aaaaaagccaaaggcgattttaaatttatcttttcaggaacgcaactttggcccaaatta
gataaaggagatcattgggacgaatttccagcagaacgacaagactttctagactttctc
caaaaagaggacatcaagggcgtagtggttattagtggagaccgacactatagcgagctc
aactgcctaaaaagagaagctgactatccgctttatgagtatacttgctctcccctgact
agttttaccgacccctattattctaaggaaaatgattgtagagaagagggtacctttgtc
cgcaaacaaaactatggcctgctgactattctgggccagggtttgcagcgcatttgccgc
atccaaacctttaatcggaaagggaagctgctctggcaaagagaaattgcccttaaagat
ttgcaataa

DBGET integrated database retrieval system