KEGG   Saprospira grandis: SGRA_1002Help
Entry
SGRA_1002         CDS       T01764                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sgn  Saprospira grandis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sgn00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sgn00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sgn00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023933..1027100
Genome map
AA seq 1055 aa AA seqDB search
MKSPVSKPIPHPPIYPIVKSVLSLDIKRPVQSMMALAEKYGGIYRLEVPNDSLVIVSGLE
YVQEFCDEDRFDKKVFSALEKVRDLTGDGLFTAHTEEPNWGKAHRILTPAFGPHAMQDMF
DKMYDVAEQLCVKLERLGPDEPFNVPANMTRLTLDTIALCAFDYRFNSFYKNEMHPFVEA
MLFILHEANQHMRRLPIMNRLMYKTKERYNKDIQYMYTVAQKILDQRRKADKAEQVDDLL
GRMLEGVDPDTGEKLSDQNIIYQMVTFLIAGHETTSSMMAFTFYEMLKQPHILARVQAEV
DEVLGQEKLQFHHLSKLKYMDMVLKECLRLWPIASGFNLRSFKDEQVGEYLIKPTDSIFI
FLPSLHRAPIWGEDPKLFNPENFSPENEAKIPPSAYLPFGNGRRSCIGRPFAFQEAKLAI
AMILQRFDISLADPNYELVLDETLTIKPDNYFLKFKKRPGFKPVENGPKVPASQSLKLKG
GKQIYVQNKPLLYLAYGSNMGSSKKFIQQLAETAQALGYQPSVHSLNETKALMAQNKGHY
VIITASYEGQPTHDAEEFVDWIVEQPEGSLDQVQYSLFGCGNSDWIHSYQAVPRKIDAQL
KRLGAQPFLAPGEGNAKQNFFASFNQWHDELWPALAKSLGQDAISPINKKSYKVQLLHDW
HAQTLGENDFVRAQLLSKKELVQQESPFASSKIELQIEVPEGQSYQTGGYIDILPQNSPA
TIQRVLRHFQMQHDPYIKLESEEQSVALKLPLDQHIRLTDLLKYYVELQRPAGKKWLEEV
LAQTRCPFSAQGLQQFIEQYESEVLQKNRSLLSIIEQFPGAKIDLGQFISALPAMRPRTY
SISSSVKQSTDKASLVVSCIKGAAWSGQGEYQGLASGYLSQLEEGQLLWLRFSPNLPNFP
APKSEDKLILIAAGTGIAPFRAFMQERSLEKTPEKAVFFYGCRAKEVDQLYAEEFAQWEK
EGWLDLRPVYSKAPEKEGQTYVQHRLWADRDAFWAAWEAGAKIYICGDGEGMAPAVRQCL
MDIYQEKAQATEAQALDWLMQIAGKDKRYFTDIFS
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcccagtttctaagcccattccccatcctcctatctaccccattgtaaaaagt
gtactcagtctagacatcaagcggcccgtgcaaagtatgatggctttggcggaaaaatac
ggtggaatttatcgcctagaagtgcccaacgacagtctagttattgtgagtggtttagag
tatgttcaagaattttgcgatgaggaccgatttgataaaaaagtattttcggccctagaa
aaagtgcgtgaccttactggagatgggctttttacggcccataccgaagagcccaactgg
gggaaagcgcaccgcattttgacccctgcttttggtccacatgccatgcaagatatgttt
gataaaatgtatgatgtggccgaacaactttgtgttaaactggaacggcttgggcctgat
gagccctttaatgttccggcaaatatgacgcgtttgacgctagacaccattgccctttgt
gcctttgactaccgctttaacagcttttacaaaaacgaaatgcacccctttgtagaggcc
atgttgtttattttgcatgaggccaatcagcatatgcggcgcctaccgatcatgaaccgt
ctgatgtataaaaccaaggagcgttataataaggacattcaatatatgtataccgtggcg
cagaaaattttggatcaaagaagaaaggcagacaaagcagagcaggtggatgatcttttg
ggccgtatgcttgagggagtagatcccgatactggcgaaaagctgagcgaccaaaacatc
atctaccaaatggtcacttttctgattgcaggacatgaaacgaccagtagcatgatggca
tttaccttctatgaaatgctcaagcagccgcatattttggcccgtgttcaggctgaagta
gatgaggtgcttggtcaggaaaagctgcagtttcatcatttgagcaagctaaagtatatg
gatatggttcttaaggagtgtttgcgcctttggcccattgcatcgggctttaaccttcgt
tcctttaaagatgaacaagtgggcgaatacctgattaagccgaccgactccattttcatc
tttttgccctctttgcatcgcgctcccatttggggagaagatcccaagctatttaacccc
gaaaacttttcgccagaaaatgaggctaaaatccccccatcggcttaccttccctttggt
aatggccgccgctcttgtattggccgcccctttgcctttcaggaagccaaactggccatt
gcgatgattttgcagcgttttgatattagcttggccgaccccaactatgagctagtttta
gatgaaacgctgactataaagcccgataactacttccttaaattcaagaaacgaccaggc
tttaagccagtagaaaatggccccaaagtacccgccagccaaagcctaaagttaaagggc
ggtaaacagatttatgtccaaaacaagcccctactctacctcgcctatggctctaatatg
ggctcctcgaaaaagtttatccaacaactagccgaaacagcccaagcattgggctatcag
cctagcgtgcatagcctcaatgaaaccaaggcattaatggcccaaaacaaagggcattat
gtcattattaccgcctcctatgagggacagcccacccatgatgccgaagaatttgtcgat
tggattgtggaacagcctgaaggtagtctagaccaagttcaatatagcctctttggttgt
ggcaactcggattggatccatagctatcaggccgttcctcggaaaattgatgcccaatta
aaacgcttaggcgctcagccatttttggcccctggagaaggcaatgccaagcaaaacttt
tttgcctcttttaaccaatggcatgatgaactctggcccgccctagccaaaagcttagga
caagatgccattagtccaatcaataaaaagagctataaggtccaattgctacacgattgg
catgcacagactttgggcgaaaatgattttgttcgggctcaactgctgagcaaaaaagaa
ttggtccaacaagagagcccctttgctagctccaaaattgagctgcaaattgaagtcccc
gaaggccaaagttatcaaactggcggctacattgatattctgccccaaaatagccccgca
actattcagcgggtgttgcgccactttcaaatgcaacatgacccctatatcaaattggag
tcagaagagcaatctgttgccctaaagttgcctttggaccaacatattcgcctgactgat
ttgctcaagtattatgtagaactacaacggcccgcaggcaaaaaatggctagaagaagtt
ttggcccaaactcgctgtcccttttcggcccaaggccttcaacagtttattgagcagtat
gagagcgaagttctgcagaaaaatcgaagtttgctcagtatcattgagcagtttcctgga
gcaaaaattgaccttggccaatttattagtgcgctgcccgctatgcgccccagaacctac
tctatttcttcttcggttaaacagtctacagataaggccagcttagtggtatcctgcatt
aagggagctgcctggtctggacaaggagagtatcaaggactagcctctggctatctcagc
caattagaagaaggccaactcctttggctccgctttagccccaatttacccaactttccc
gcccccaaaagcgaagataaactcattcttattgccgcaggtacggggattgctcccttt
agagcctttatgcaagaacgcagcctagagaaaacgccagaaaaagcagtatttttctat
ggttgccgagccaaagaagtggatcaactttatgcagaagagtttgcgcaatgggaaaaa
gaaggttggttggatttacgtcccgtttactctaaagcgcccgaaaaagaaggccaaact
tatgtacaacaccgcctttgggccgatagagatgccttctgggccgcttgggaagcagga
gccaaaatctatatctgtggagatggcgaaggcatggccccagccgtacgccaatgcctg
atggatatttaccaagaaaaggcccaagctacagaagcccaagccctagattggttgatg
caaattgccggtaaggacaaacgctattttaccgatatttttagctaa

DBGET integrated database retrieval system