KEGG   Saprospira grandis: SGRA_1002Help
Entry
SGRA_1002         CDS       T01764                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sgn  Saprospira grandis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SGRA_1002
  Amino acid metabolism
   00380 Tryptophan metabolism
    SGRA_1002
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SGRA_1002
Enzymes [BR:sgn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SGRA_1002
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SGRA_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1023933..1027100
Genome map
AA seq 1055 aa AA seqDB search
MKSPVSKPIPHPPIYPIVKSVLSLDIKRPVQSMMALAEKYGGIYRLEVPNDSLVIVSGLE
YVQEFCDEDRFDKKVFSALEKVRDLTGDGLFTAHTEEPNWGKAHRILTPAFGPHAMQDMF
DKMYDVAEQLCVKLERLGPDEPFNVPANMTRLTLDTIALCAFDYRFNSFYKNEMHPFVEA
MLFILHEANQHMRRLPIMNRLMYKTKERYNKDIQYMYTVAQKILDQRRKADKAEQVDDLL
GRMLEGVDPDTGEKLSDQNIIYQMVTFLIAGHETTSSMMAFTFYEMLKQPHILARVQAEV
DEVLGQEKLQFHHLSKLKYMDMVLKECLRLWPIASGFNLRSFKDEQVGEYLIKPTDSIFI
FLPSLHRAPIWGEDPKLFNPENFSPENEAKIPPSAYLPFGNGRRSCIGRPFAFQEAKLAI
AMILQRFDISLADPNYELVLDETLTIKPDNYFLKFKKRPGFKPVENGPKVPASQSLKLKG
GKQIYVQNKPLLYLAYGSNMGSSKKFIQQLAETAQALGYQPSVHSLNETKALMAQNKGHY
VIITASYEGQPTHDAEEFVDWIVEQPEGSLDQVQYSLFGCGNSDWIHSYQAVPRKIDAQL
KRLGAQPFLAPGEGNAKQNFFASFNQWHDELWPALAKSLGQDAISPINKKSYKVQLLHDW
HAQTLGENDFVRAQLLSKKELVQQESPFASSKIELQIEVPEGQSYQTGGYIDILPQNSPA
TIQRVLRHFQMQHDPYIKLESEEQSVALKLPLDQHIRLTDLLKYYVELQRPAGKKWLEEV
LAQTRCPFSAQGLQQFIEQYESEVLQKNRSLLSIIEQFPGAKIDLGQFISALPAMRPRTY
SISSSVKQSTDKASLVVSCIKGAAWSGQGEYQGLASGYLSQLEEGQLLWLRFSPNLPNFP
APKSEDKLILIAAGTGIAPFRAFMQERSLEKTPEKAVFFYGCRAKEVDQLYAEEFAQWEK
EGWLDLRPVYSKAPEKEGQTYVQHRLWADRDAFWAAWEAGAKIYICGDGEGMAPAVRQCL
MDIYQEKAQATEAQALDWLMQIAGKDKRYFTDIFS
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcccagtttctaagcccattccccatcctcctatctaccccattgtaaaaagt
gtactcagtctagacatcaagcggcccgtgcaaagtatgatggctttggcggaaaaatac
ggtggaatttatcgcctagaagtgcccaacgacagtctagttattgtgagtggtttagag
tatgttcaagaattttgcgatgaggaccgatttgataaaaaagtattttcggccctagaa
aaagtgcgtgaccttactggagatgggctttttacggcccataccgaagagcccaactgg
gggaaagcgcaccgcattttgacccctgcttttggtccacatgccatgcaagatatgttt
gataaaatgtatgatgtggccgaacaactttgtgttaaactggaacggcttgggcctgat
gagccctttaatgttccggcaaatatgacgcgtttgacgctagacaccattgccctttgt
gcctttgactaccgctttaacagcttttacaaaaacgaaatgcacccctttgtagaggcc
atgttgtttattttgcatgaggccaatcagcatatgcggcgcctaccgatcatgaaccgt
ctgatgtataaaaccaaggagcgttataataaggacattcaatatatgtataccgtggcg
cagaaaattttggatcaaagaagaaaggcagacaaagcagagcaggtggatgatcttttg
ggccgtatgcttgagggagtagatcccgatactggcgaaaagctgagcgaccaaaacatc
atctaccaaatggtcacttttctgattgcaggacatgaaacgaccagtagcatgatggca
tttaccttctatgaaatgctcaagcagccgcatattttggcccgtgttcaggctgaagta
gatgaggtgcttggtcaggaaaagctgcagtttcatcatttgagcaagctaaagtatatg
gatatggttcttaaggagtgtttgcgcctttggcccattgcatcgggctttaaccttcgt
tcctttaaagatgaacaagtgggcgaatacctgattaagccgaccgactccattttcatc
tttttgccctctttgcatcgcgctcccatttggggagaagatcccaagctatttaacccc
gaaaacttttcgccagaaaatgaggctaaaatccccccatcggcttaccttccctttggt
aatggccgccgctcttgtattggccgcccctttgcctttcaggaagccaaactggccatt
gcgatgattttgcagcgttttgatattagcttggccgaccccaactatgagctagtttta
gatgaaacgctgactataaagcccgataactacttccttaaattcaagaaacgaccaggc
tttaagccagtagaaaatggccccaaagtacccgccagccaaagcctaaagttaaagggc
ggtaaacagatttatgtccaaaacaagcccctactctacctcgcctatggctctaatatg
ggctcctcgaaaaagtttatccaacaactagccgaaacagcccaagcattgggctatcag
cctagcgtgcatagcctcaatgaaaccaaggcattaatggcccaaaacaaagggcattat
gtcattattaccgcctcctatgagggacagcccacccatgatgccgaagaatttgtcgat
tggattgtggaacagcctgaaggtagtctagaccaagttcaatatagcctctttggttgt
ggcaactcggattggatccatagctatcaggccgttcctcggaaaattgatgcccaatta
aaacgcttaggcgctcagccatttttggcccctggagaaggcaatgccaagcaaaacttt
tttgcctcttttaaccaatggcatgatgaactctggcccgccctagccaaaagcttagga
caagatgccattagtccaatcaataaaaagagctataaggtccaattgctacacgattgg
catgcacagactttgggcgaaaatgattttgttcgggctcaactgctgagcaaaaaagaa
ttggtccaacaagagagcccctttgctagctccaaaattgagctgcaaattgaagtcccc
gaaggccaaagttatcaaactggcggctacattgatattctgccccaaaatagccccgca
actattcagcgggtgttgcgccactttcaaatgcaacatgacccctatatcaaattggag
tcagaagagcaatctgttgccctaaagttgcctttggaccaacatattcgcctgactgat
ttgctcaagtattatgtagaactacaacggcccgcaggcaaaaaatggctagaagaagtt
ttggcccaaactcgctgtcccttttcggcccaaggccttcaacagtttattgagcagtat
gagagcgaagttctgcagaaaaatcgaagtttgctcagtatcattgagcagtttcctgga
gcaaaaattgaccttggccaatttattagtgcgctgcccgctatgcgccccagaacctac
tctatttcttcttcggttaaacagtctacagataaggccagcttagtggtatcctgcatt
aagggagctgcctggtctggacaaggagagtatcaaggactagcctctggctatctcagc
caattagaagaaggccaactcctttggctccgctttagccccaatttacccaactttccc
gcccccaaaagcgaagataaactcattcttattgccgcaggtacggggattgctcccttt
agagcctttatgcaagaacgcagcctagagaaaacgccagaaaaagcagtatttttctat
ggttgccgagccaaagaagtggatcaactttatgcagaagagtttgcgcaatgggaaaaa
gaaggttggttggatttacgtcccgtttactctaaagcgcccgaaaaagaaggccaaact
tatgtacaacaccgcctttgggccgatagagatgccttctgggccgcttgggaagcagga
gccaaaatctatatctgtggagatggcgaaggcatggccccagccgtacgccaatgcctg
atggatatttaccaagaaaaggcccaagctacagaagcccaagccctagattggttgatg
caaattgccggtaaggacaaacgctattttaccgatatttttagctaa

DBGET integrated database retrieval system