KEGG   Saprospira grandis: SGRA_1005Help
Entry
SGRA_1005         CDS       T01764                                 

Definition
(GenBank) aminopeptidase (EC:3.2.1.4)
Organism
sgn  Saprospira grandis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1028265..1029329)
Genome map
AA seq 354 aa AA seqDB search
MEKLNIPLLSTICKTAAPPGFEQRLRQFVESEVTDLVDDCFTDALGNLYAVRKGTAEGPK
KKIMVAAHLDEIGFIVTHIEEGGFLRFHTLGGFDPKTLSSQRVIVHGKKDIVGVMGSKPI
HLMSAAERGKNLSIKDYFIDTGMSKEELEKYVSVGDPISRERELIEMGDCVNSKSLDNRL
AVFILLECLRELKDEQLDYDVYGVFTVQEEVGLRGARVAAHNINPDFGLGLDITIAFDVP
GAQAHEKITALGAGTAIKIMDGSSICDYRMVQFMKETADAAEIPWQPEILTGGGSDTGGL
QLYGKSGAITGAISIPCRHVHQTVEMAHKEDIYQSIQLLKQCLLNISKYDWSFR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggagaaactaaatatccctttgctcagtacaatttgtaaaacggcggcgcctcctggt
tttgagcagcgcctgcgtcagtttgtagaatcggaagtaacggatttggtagatgattgt
tttacagatgctttgggcaatttgtatgcggttcggaagggaactgccgaggggcccaag
aaaaagatcatggtggcggcccatttggatgagattggatttattgtcactcatattgag
gagggcggctttttgcgctttcataccctgggtggttttgaccccaaaacactgagctcg
caaagggtaattgtgcatggcaaaaaggatattgtgggggtaatgggcagcaaacccatc
catttgatgtcggctgcagaaagaggtaaaaacttgagcatcaaggattattttattgat
acgggtatgagcaaggaagagctggagaagtacgtatcggtaggtgaccctattagtcga
gagcgggagttgattgaaatgggcgattgcgtgaattctaagtctttggacaaccgtttg
gccgttttcattttgctcgaatgcttgcgagagctcaaagacgagcagctcgattatgat
gtttatggtgtttttacggtccaagaagaggtgggcttgcgtggtgctcgggtggctgca
cataatattaaccccgattttggtttgggtttagatattactattgcctttgatgtacct
ggggctcaggcgcatgaaaaaattacggctttgggcgcagggaccgccattaaaattatg
gatggctcgagtatttgcgattatcgcatggttcaatttatgaaagaaacagccgatgcg
gcagaaattccttggcagcctgaaatcttgaccggagggggcagtgatacgggtggtttg
cagctatatggaaagtctggggccattacgggcgccatttccattccttgtcgacatgtg
caccaaactgtagaaatggctcataaagaggatatttaccaaagcattcagctcctcaag
cagtgcttattgaatatttctaaatacgattggtccttccgttaa

DBGET integrated database retrieval system