KEGG   Saprospira grandis: SGRA_1247Help
Entry
SGRA_1247         CDS       T01764                                 

Definition
phosphoglycerate mutase family protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sgn  Saprospira grandis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_1247
   01230 Biosynthesis of amino acids
    SGRA_1247
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRA_1247
  Energy metabolism
   00680 Methane metabolism
    SGRA_1247
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGRA_1247
Enzymes [BR:sgn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SGRA_1247
Exosome [BR:sgn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SGRA_1247
  Exosomal proteins of melanoma cells
   SGRA_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270508..1271020)
Genome map
AA seq 170 aa AA seqDB search
MKLYLVRHAQPAPKEYRGFPGPALGEKGKEQALAIAQYLAKKDIQAVYCSDYLRVGQTYA
PYAQLVPALQPKVVQALREREKEIEPHESLEQRVQDWYRGEQQQLWARPTAIFSHCGPIN
MILEYLDPKKELLDYPYTCPYGCHTPLGSIWELEIGEAGGVEGGLWWNPK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttatctagtgcgtcatgcccagcctgcccccaaagaatatcggggttttccg
gggccagccttgggcgaaaagggaaaagagcaagctctagccattgcccaatatttagca
aagaaagatattcaggccgtatattgtagcgattatttgcgggtagggcagacctatgcg
ccctatgctcagcttgtgccagctttgcagccgaaagtagtgcaggcattaagagaaaga
gagaaagaaatagagccgcatgagtcactagaacaaagagtgcaggattggtatcgggga
gagcagcagcagttatgggctcggcccacggccatctttagccattgtgggcccatcaat
atgattttggagtatttggaccccaagaaagagctactcgactacccctatacttgtccc
tatggttgccatacgcctttgggcagtatttgggagctagaaattggagaggctggggga
gtagaaggggggctttggtggaatcccaagtag

DBGET integrated database retrieval system