KEGG   Saprospira grandis: SGRA_1679Help
Entry
SGRA_1679         CDS       T01764                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sgn  Saprospira grandis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sgn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1694732..1695520
Genome map
AA seq 262 aa AA seqDB search
MSSVEAKERLKRVESILVTQMTTKNNKAPYDRLVEKYGIKVDYRPFTEVRPVSAKEFRKQ
KVKLEEYSAIIFTSKSAIDHYFRLCEEMRYKVPAETKYFCLSEAIALYLQKHTTYRKRRV
FFGKRTLQDLKPYLLKHKKKETFLLPSSNLGKKAYETFLEAEGFNFVVSEMYLAASSDIS
DLEDVFYDILVFFSPLSLDSLYDNFPDFKQNNTRIAVYGNSTAKAIEAKGLYIDIKVPNP
EFPKIRSMAEAIEHYIKEANDL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgtggaagcaaaagaaagattgaagcgcgtagagagtattttggtgactcaa
atgactaccaaaaataataaagctccctatgaccgcttagtagagaagtacggtattaag
gtggattatcgcccatttacagaggttcggcccgtttcggccaaggagtttcgcaaacaa
aaggtaaagctagaagagtattcggctattatttttacctctaagtcggctattgaccac
tattttcgcctttgtgaggagatgcgctataaggtgcctgcagagaccaagtatttttgc
ctctctgaagcgattgccctttatttgcaaaagcataccacttaccgcaagcgccgtgtc
ttttttggcaaaagaaccttgcaagacctcaaaccttatttgctgaagcataagaagaaa
gagaccttcttgctgccctcttctaatttgggcaaaaaagcctatgagacttttctagaa
gctgagggctttaattttgtcgtttctgaaatgtacctagccgctagctcggatatttct
gacctagaggatgttttctatgatattttggtcttttttagcccattgagtctagactcg
ctctacgataactttcccgactttaagcaaaataatactcgtattgccgtttatggcaat
tctaccgccaaagccattgaggccaaaggcttgtatattgatattaaggtccctaatcca
gagtttcccaaaatccgctctatggccgaggctattgagcactatataaaggaagccaac
gacctttaa

DBGET integrated database retrieval system