KEGG   Saprospira grandis: SGRA_1976Help
Entry
SGRA_1976         CDS       T01764                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgn  Saprospira grandis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_1976 (pfk)
   01230 Biosynthesis of amino acids
    SGRA_1976 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRA_1976 (pfk)
   00030 Pentose phosphate pathway
    SGRA_1976 (pfk)
   00051 Fructose and mannose metabolism
    SGRA_1976 (pfk)
   00052 Galactose metabolism
    SGRA_1976 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SGRA_1976 (pfk)
Enzymes [BR:sgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGRA_1976 (pfk)
Protein phosphatases and associated proteins [BR:sgn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGRA_1976 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1993954..1994931)
Genome map
AA seq 325 aa AA seqDB search
MKKIAVFTSGGDSPGMNACIRAVVRAAIYNQVEVLGIRRGYAGMILGDFVPLDREGVQGI
INRGGTILGSARSAEFMTPEGRQKAFEQLQAAGVDGVVVIGGDGSFKGATVFMEEHPEIP
FVGIPGTIDNDLYGTDYTLGYDTAINTALEAIDKIRDTAEAYNRLFFVEVMGRDAGFIAL
RSGIAGGAEAILVPEVETDIPLLIQQIGEYHEKHKHSCIIVVAEGDDAGGAFELAKQVQD
KVPYEESRVTVLGHIQRGGTPTCADRVLAAQMGIGAVEALLANKRGIMIGVQHKQVVEVP
FEQSTKHNIEISPSLKKVAHILSAI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtttttacatcaggaggcgattcgcctggaatgaatgcttgcatt
cgcgcagtggtgcgggccgctatttataatcaagtagaggtgctcggtatccgtagaggc
tatgcgggaatgattttaggagattttgttcccttagaccgagaaggggtgcagggcatc
attaatagaggcgggaccattttgggctctgcccgctctgctgaattcatgacgcccgaa
ggtcgccaaaaagcctttgaacaattgcaagcagctggagtagatggggttgtggtcatt
ggaggcgatggttcttttaagggagctacggtttttatggaagaacatcccgaaattcct
tttgtgggcattccgggcaccatagacaacgatctatatggaacagattataccttgggc
tatgatacggccatcaatacggccctagaagccattgataaaatccgtgatactgccgag
gcctacaaccgcttattttttgtagaagttatgggccgagatgcgggctttattgccctg
cgttcgggaattgctggcggggccgaggccattttggtccctgaagtagaaacagacatc
cctttgctgattcagcaaattggggaataccatgagaagcacaaacactcttgtattatt
gtagtggccgaaggcgatgatgctggtggcgcctttgaattggccaagcaagtgcaagat
aaggtcccttatgaagaaagccgagtgacggttttgggccatattcagcgaggaggaacc
cctacttgtgccgaccgtgtgctggccgcccaaatgggcattggcgcagtagaagcccta
ttggccaataaaagaggaataatgataggggtacagcacaaacaagttgtagaagtcccc
tttgagcaatctaccaaacacaatatcgaaattagccccagcctgaaaaaagtagcccat
attctttcggctatttag

DBGET integrated database retrieval system