KEGG   Saprospira grandis: SGRA_2015Help
Entry
SGRA_2015         CDS       T01764                                 

Definition
porphobilinogen deaminase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sgn  Saprospira grandis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGRA_2015
Enzymes [BR:sgn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SGRA_2015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2032369..2033034
Genome map
AA seq 221 aa AA seqDB search
MQKIFISRKLAEQSDFRRLLANRAELIDYSLLRFRPTNFSWPKDTDCYFFYSPRGLRYAL
DQWKKPWEQLPLIAALGPATAAVLQEFGLSADFIGSGRPAPTALAFKEWLGQKSVCFFRA
EQSKRSIQQLLKGEILAKERIVYSNQAKTQFADSQADILVLTSPLNAETYLKAYPKKKNQ
EILVIGRSTAQKLMEMGYSDFHLATAPKEEALAQYCLRYLL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatttttatttccagaaaactagccgagcagagtgactttaggcgcttattg
gctaatcgggcagagctcatagattactctctattaaggtttcggcccactaactttagt
tggcccaaagatacggactgttattttttttacagccccagagggctgcgctatgccttg
gaccaatggaaaaaaccctgggagcagcttcctttgattgctgctttggggccagcaaca
gccgcagtacttcaagaatttggtttaagcgcagattttattggttctggccggccggcc
cctactgccctagcctttaaagaatggctgggccaaaaaagcgtttgcttttttcgggcc
gaacagtctaaacgctctattcaacaactgctcaaaggcgagattttggccaaggaacgc
attgtttatagcaaccaagccaaaacccaatttgccgacagccaagccgatattttagtt
ctgaccagcccgctcaatgccgaaacctatttaaaggcataccccaaaaagaaaaatcaa
gaaattctagtcattggacgcagcacggcccaaaaactcatggaaatgggctatagtgat
tttcatttggctacggcccccaaagaagaggctctcgcccaatactgcctgcgctactta
ttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system