KEGG   Saprospira grandis: SGRA_2299Help
Entry
SGRA_2299         CDS       T01764                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sgn  Saprospira grandis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGRA_2299 (asnB)
Enzymes [BR:sgn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SGRA_2299 (asnB)
Peptidases [BR:sgn01002]
 Cysteine Peptidases
  Family C44
   SGRA_2299 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2335461..2337368
Genome map
AA seq 635 aa AA seqDB search
MCRLSGFWDFSSPTYDPQAVLQKMRDSLQHGGPDYGGAFLDAETGLALGHRRLSIIDLSP
AGNQPLYYKEKALIFNGEIYNYQEIRKELELLGRAFQTESDTEVLFQALEEWGEAAVNRF
HGMFAFALWDKANKELLICRDRLGVKPLYYYYQDGLFLFASELKAFHQHPRFRKEISPQA
VSLYLQQGYIPAPYCIFKGCQKLKGGHFLKLNQKGELKTYPYWSLAERYAAAEIPDASEA
ELKSALEKELRKSFALRMVADVPVGVFLSGGVDSSIVAALLQDQSAQQLRTFTIGFKDKE
YNEANQAKAVAEHIGSQHEELYCGPEDFEQLIPNWAELYDEPFGDSSGIPTYLVAQMAKQ
SVKVSLSADGGDELFGGYTKYEVCQRFYPKIKKLGPLRPLAAALMGQINPFWLERNASKL
PILKGYKNISNKWPKLVAALGAKDQEAFFHQSSSYISPQKHQALFGSPTPRYQGELKPKA
GRYIGYLGSLDLLTYLEGDIMVKVDRATMAVALEGREPLLDHQLLDFALSLPDELKIRSG
QGKYLLRQLLYDYVPKDLIERPKQGFSIPIEQWLRGLLRPDLEALAQDKAFADCFGLQQT
VLEDMLRQFLDRKAYINPHFIWFLYVLRQWYKRWF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagacttagcggattttgggatttttctagccctacttatgaccctcaggcggtt
ttgcaaaaaatgcgagatagcctgcagcatggtggtcccgattatggcggcgctttttta
gatgcggaaacgggcctggccctaggccatcgccgcttgtccattattgacttgagcccc
gccggcaaccaaccgctttattataaagagaaggccctgatttttaatggggaaatttat
aattatcaggagatccgcaaggagctggagcttttgggccgtgcttttcaaacagaatcg
gatacggaggtgctttttcaggccctagaagaatggggcgaggctgccgtcaatcgcttt
catggtatgtttgcttttgcgctttgggataaggccaataaggagctattaatttgccga
gatcgtttgggcgtaaagccgctctactattattatcaggatgggctctttttgtttgcc
tcggagctcaaagctttccatcaacatcctcgttttcgcaaagaaatttcgcctcaggcg
gtttcgctttatttgcagcagggctatattccagcgccctattgcatttttaagggctgc
caaaagctaaaagggggacattttctcaagctcaaccaaaagggcgagctgaaaacttat
ccctattggtctttggcggaacgttatgcagctgcagaaattccagatgcctcagaagcg
gaactcaagtcggctttggagaaagagttgcgaaaatcttttgccttgcggatggtggct
gatgtgcccgtgggcgtatttttgtcggggggagtagattcttcgattgtggcggctttg
ctacaagatcaatcggcccaacagctgcgcacttttaccattgggtttaaggacaaagaa
tataatgaggccaatcaggccaaggccgtggcggagcatattggtagccagcatgaggag
ctttattgtggaccagaagattttgagcagctgattcccaattgggccgaactatatgac
gagccttttggcgatagctctggcattcctacttatttggtggctcaaatggccaaacaa
tcggtcaaagtgagtctttcggccgatggtggcgatgaactttttggcggctacactaaa
tatgaggtctgtcaacgtttttatccgaaaataaagaaattggggccccttcgccccttg
gcagctgcattaatgggccaaattaatcccttttggttagagcggaatgccagtaaattg
cccattctcaaaggctataaaaatattagcaacaaatggccgaaattggtggctgctttg
ggcgccaaggaccaagaggcttttttccatcagtcttcctcttatatttcgccccaaaag
catcaggctttatttggatcccccacgcctcgctatcaaggcgagctcaagcccaaagcg
gggcgatatattgggtatttgggcagtttagatttgctcacttatctagaaggcgatatt
atggttaaggtggatcgggccacgatggccgtcgctttggagggccgagagcccttattg
gaccatcaactgctcgattttgcgctttctttgcccgatgagctcaaaattcgctcgggc
caaggcaaatatttgttgcggcagctgctgtatgattatgtccccaaagacttaattgaa
cgccccaagcagggattttcaatccccattgagcaatggctgcggggcttgctccgccca
gacttagaagctttggcccaagataaggcctttgccgattgctttgggctgcaacaaacg
gtcttagaagatatgttgcggcagtttttagaccgcaaagcttatatcaaccctcatttc
atctggttcttgtatgtgcttcggcagtggtacaagcgctggttctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system