KEGG   Saprospira grandis: SGRA_2495Help
Entry
SGRA_2495         CDS       T01764                                 

Gene name
pcm
Definition
protein-l-isoaspartate(D-aspartate) o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sgn  Saprospira grandis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2538881..2539540
Genome map
AA seq 219 aa AA seqDB search
MQDTYRHKGMRRKLLQQLQKNAAFRPEVLAAIGSLPRHFFVDSAFEELAYKDQALPIGGG
QTLSQPSTVAWQCSLLELSAGQRILEIGTGSGYQAAILQRMGAELDTYERQEALQLAAKK
RFDALKLENLRSYFGDASELPLAEPPYDGILMSCAAEQIPKQLLARLKIGGRMVLPLLYQ
EQQRMFVVERKGEKTFEYEDCGPCRFVPFLKGALPVQRK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatacctacagacataaggggatgaggcggaagcttttgcagcaattgcaaaaa
aacgcggcttttcgtccagaggttttggcagcaatagggagtctgccaaggcattttttt
gtggactctgcttttgaggaactggcctataaggatcaggcgctacctattggtgggggg
caaacgctttcgcagccttctacggtggcttggcaatgtagtttgttggagctaagcgct
gggcagcgcattttagaaattggaacgggttcgggttatcaggcggccatattgcaaaga
atgggagccgagctagatacctatgagcggcaagaggccttgcagttggcggcaaaaaag
cgctttgatgcgctaaagctagaaaatttgcgttcttattttggcgatgcaagcgagttg
cctttggcagagccgccctatgatggcattttgatgagctgtgcggccgaacagattccc
aagcagttattggcccgattgaaaattgggggacggatggttttgcccttgctttatcag
gagcagcagcggatgtttgttgtagagcgaaagggagaaaaaacctttgaatatgaggat
tgtggtccctgccgttttgttccttttttgaagggagccctgcctgtgcagagaaagtag

DBGET integrated database retrieval system