KEGG   Saprospira grandis: SGRA_2517Help
Entry
SGRA_2517         CDS       T01764                                 

Gene name
fadJ
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sgn  Saprospira grandis
Pathway
sgn00071  Fatty acid degradation
sgn00280  Valine, leucine and isoleucine degradation
sgn00281  Geraniol degradation
sgn00310  Lysine degradation
sgn00362  Benzoate degradation
sgn00380  Tryptophan metabolism
sgn00410  beta-Alanine metabolism
sgn00640  Propanoate metabolism
sgn00650  Butanoate metabolism
sgn00903  Limonene and pinene degradation
sgn00930  Caprolactam degradation
sgn01040  Biosynthesis of unsaturated fatty acids
sgn01100  Metabolic pathways
sgn01110  Biosynthesis of secondary metabolites
sgn01120  Microbial metabolism in diverse environments
sgn01130  Biosynthesis of antibiotics
sgn01200  Carbon metabolism
sgn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SGRA_2517 (fadJ)
   00650 Butanoate metabolism
    SGRA_2517 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SGRA_2517 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SGRA_2517 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGRA_2517 (fadJ)
   00310 Lysine degradation
    SGRA_2517 (fadJ)
   00380 Tryptophan metabolism
    SGRA_2517 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGRA_2517 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGRA_2517 (fadJ)
   00281 Geraniol degradation
    SGRA_2517 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGRA_2517 (fadJ)
   00930 Caprolactam degradation
    SGRA_2517 (fadJ)
Enzymes [BR:sgn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SGRA_2517 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGRA_2517 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SGRA_2517 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 2-Hacid_dh_C F420_oxidored Pyr_redox_2 UDPG_MGDP_dh_N NAD_Gly3P_dh_N AlaDh_PNT_C TraC
Motif
Other DBs
NCBI-ProteinID: AFC25245
UniProt: H6L5M9
Position
complement(2564063..2566177)
Genome map
AA seq 704 aa AA seqDB search
MIYYKKDSEGIVSLTLDKSGERVNTINPQIAKAFLPVLDHLEADKSLKGVIILSAKRSFL
AGGDLDFLHRAEEPAKIFEHTALLGEIYRRFERLKVPVVAAINGAALGSGFELVLACHYR
IALDHPRTLLGLPELSLGMIPGGGGIIRLMWMLGLEEAYKFISSSRQIHVKEALQKGIID
EAVERPEELIRNAKRWILSSPCIEKPWDAEDRIAKESNPKHPKTAQRIAKLSTELIAKTR
NNYPALLSLLNCMAEGASVDFDAATRINARYFTAMIMSKNCRNQTKAFWYDLNKIKQGMS
RPKGFGRFRARKIGVIGAGQMGSGIAYVAAMQGIEVLLRDVSKRLAEQGKNNAREKLSRL
EKSGKMTTEQAEEILNRIQTTSDLREMEDCDLVIEAVFENMALKQRIIKEVELEMQQHSF
LATNTASLQVSDLAQASIQPENYIGMHFFTPINRIPLVEIIVGKKTADETVARAFDFVLQ
LRKTPIIVQDRPAFFVSRVASTYFMEGILLLKEGQGPAAIENAGLQAGMPMGPLAFADNL
GFKYIISAEEQAAQQLDGRYQASPAIAVLQEMLAQERYGKARNGGFYNYKEEPVRLWGQL
KENFPLAQEQLLPKDLQDRLLFIQCLEAVRCLEEGVIQNSYDANLGSIYGWGFAPFKGGV
IQFINDYGLREFVARAEVLAQRFGPRFKPSASLLEMAEQDTNFL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatatattataagaaagatagtgagggaattgttagcctcaccttagataaaagcggc
gagcgagtcaatacgattaacccacagattgctaaggcttttttgcctgtattggaccat
ctggaagcggacaaaagcttgaagggcgtcattatcctatcggccaaacgctcttttttg
gcgggtggcgaccttgattttttgcaccgagccgaggaacccgctaagatttttgaacat
acggctctcttgggggagatttacagacgttttgaacgcttgaaagtgcccgtagtggcg
gccattaacggcgcggctttgggcagtggttttgaattggtgctggcctgtcattatcgc
attgcgctagaccaccccaggaccttattgggcttgcccgaactatcgctggggatgatt
cccggcggcggaggcattattcgcctgatgtggatgctgggcctagaagaagcctataaa
tttattagtagcagccgccaaatacacgttaaagaggccttgcaaaaaggcattattgat
gaggccgtagagcgtcccgaggagcttatccgcaacgctaagcgctggatcctctcttcg
ccttgtatcgaaaaaccctgggatgccgaagatcgcattgccaaggaaagtaaccctaaa
catccaaaaacggcccagcgcattgccaaactaagcacagagctaattgccaaaacccga
aacaactaccccgccctgctctctctactcaactgcatggccgaaggggcctctgttgat
tttgatgcggccacccgaatcaatgcccgctactttacggccatgattatgagtaaaaat
tgccgtaaccagactaaagccttttggtatgatttgaataaaatcaagcaagggatgagt
cgccctaagggctttggccgctttagggcccgaaagatcggcgttattggggctgggcaa
atgggatcgggcattgcctatgtggcggccatgcaaggcatagaagtattgcttcgagat
gtgagcaaacgcctagccgagcaaggaaaaaacaacgccagagagaagcttagccgctta
gagaaaagtgggaaaatgaccacagagcaggccgaggagattctgaaccgcatacaaacc
accagtgatttgcgggagatggaagattgcgatttggtcattgaggccgtctttgaaaat
atggccttaaagcagcgcatcattaaagaagtggagctagagatgcagcaacatagcttt
ttggccaccaatacggcttctttgcaggtatctgatttggcccaggccagcatacagcct
gaaaactatattggaatgcacttttttacgcccattaaccgcattcccttagtcgaaatt
attgtgggcaagaagaccgcagatgaaaccgtagctcgggccttcgactttgtattgcaa
ttgcgtaaaacgcccattattgtgcaggaccgtcccgccttttttgtctctagagtggcc
agcacctactttatggagggcattttactgctcaaagaggggcaggggcctgcggccata
gaaaatgcgggtttgcaggcgggtatgcccatggggcccctagcctttgccgataatttg
ggatttaagtacattatttcggcagaagagcaggctgcccagcagctagatggccgctat
caggcctcgcccgctattgctgtattgcaagaaatgctggcccaagagcgctatggcaaa
gctcggaatgggggcttttataactacaaggaagagcccgtccgtttgtgggggcagctc
aaagagaactttcccttggcccaagagcaattgttgcccaaagatttgcaagaccgtctg
ctttttattcagtgcctagaggcggttcgctgtctagaggagggcgtcattcagaatagc
tatgatgccaacttaggaagtatttacggctggggctttgctccttttaaggggggcgtg
attcagtttatcaatgattatggtttgcgggaatttgtggctcgggcagaggtgttggcc
cagcgttttggtccccgcttcaagccttctgccagcttattagagatggccgaacaggat
actaattttctctaa

DBGET integrated database retrieval system