KEGG   Saprospira grandis: SGRA_2517Help
Entry
SGRA_2517         CDS       T01764                                 

Gene name
fadJ
Definition
3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sgn  Saprospira grandis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_2517 (fadJ)
   01212 Fatty acid metabolism
    SGRA_2517 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SGRA_2517 (fadJ)
   00650 Butanoate metabolism
    SGRA_2517 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    SGRA_2517 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    SGRA_2517 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGRA_2517 (fadJ)
   00310 Lysine degradation
    SGRA_2517 (fadJ)
   00380 Tryptophan metabolism
    SGRA_2517 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGRA_2517 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGRA_2517 (fadJ)
   00281 Geraniol degradation
    SGRA_2517 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SGRA_2517 (fadJ)
Enzymes [BR:sgn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SGRA_2517 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGRA_2517 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SGRA_2517 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2564063..2566177)
Genome map
AA seq 704 aa AA seqDB search
MIYYKKDSEGIVSLTLDKSGERVNTINPQIAKAFLPVLDHLEADKSLKGVIILSAKRSFL
AGGDLDFLHRAEEPAKIFEHTALLGEIYRRFERLKVPVVAAINGAALGSGFELVLACHYR
IALDHPRTLLGLPELSLGMIPGGGGIIRLMWMLGLEEAYKFISSSRQIHVKEALQKGIID
EAVERPEELIRNAKRWILSSPCIEKPWDAEDRIAKESNPKHPKTAQRIAKLSTELIAKTR
NNYPALLSLLNCMAEGASVDFDAATRINARYFTAMIMSKNCRNQTKAFWYDLNKIKQGMS
RPKGFGRFRARKIGVIGAGQMGSGIAYVAAMQGIEVLLRDVSKRLAEQGKNNAREKLSRL
EKSGKMTTEQAEEILNRIQTTSDLREMEDCDLVIEAVFENMALKQRIIKEVELEMQQHSF
LATNTASLQVSDLAQASIQPENYIGMHFFTPINRIPLVEIIVGKKTADETVARAFDFVLQ
LRKTPIIVQDRPAFFVSRVASTYFMEGILLLKEGQGPAAIENAGLQAGMPMGPLAFADNL
GFKYIISAEEQAAQQLDGRYQASPAIAVLQEMLAQERYGKARNGGFYNYKEEPVRLWGQL
KENFPLAQEQLLPKDLQDRLLFIQCLEAVRCLEEGVIQNSYDANLGSIYGWGFAPFKGGV
IQFINDYGLREFVARAEVLAQRFGPRFKPSASLLEMAEQDTNFL
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatatattataagaaagatagtgagggaattgttagcctcaccttagataaaagcggc
gagcgagtcaatacgattaacccacagattgctaaggcttttttgcctgtattggaccat
ctggaagcggacaaaagcttgaagggcgtcattatcctatcggccaaacgctcttttttg
gcgggtggcgaccttgattttttgcaccgagccgaggaacccgctaagatttttgaacat
acggctctcttgggggagatttacagacgttttgaacgcttgaaagtgcccgtagtggcg
gccattaacggcgcggctttgggcagtggttttgaattggtgctggcctgtcattatcgc
attgcgctagaccaccccaggaccttattgggcttgcccgaactatcgctggggatgatt
cccggcggcggaggcattattcgcctgatgtggatgctgggcctagaagaagcctataaa
tttattagtagcagccgccaaatacacgttaaagaggccttgcaaaaaggcattattgat
gaggccgtagagcgtcccgaggagcttatccgcaacgctaagcgctggatcctctcttcg
ccttgtatcgaaaaaccctgggatgccgaagatcgcattgccaaggaaagtaaccctaaa
catccaaaaacggcccagcgcattgccaaactaagcacagagctaattgccaaaacccga
aacaactaccccgccctgctctctctactcaactgcatggccgaaggggcctctgttgat
tttgatgcggccacccgaatcaatgcccgctactttacggccatgattatgagtaaaaat
tgccgtaaccagactaaagccttttggtatgatttgaataaaatcaagcaagggatgagt
cgccctaagggctttggccgctttagggcccgaaagatcggcgttattggggctgggcaa
atgggatcgggcattgcctatgtggcggccatgcaaggcatagaagtattgcttcgagat
gtgagcaaacgcctagccgagcaaggaaaaaacaacgccagagagaagcttagccgctta
gagaaaagtgggaaaatgaccacagagcaggccgaggagattctgaaccgcatacaaacc
accagtgatttgcgggagatggaagattgcgatttggtcattgaggccgtctttgaaaat
atggccttaaagcagcgcatcattaaagaagtggagctagagatgcagcaacatagcttt
ttggccaccaatacggcttctttgcaggtatctgatttggcccaggccagcatacagcct
gaaaactatattggaatgcacttttttacgcccattaaccgcattcccttagtcgaaatt
attgtgggcaagaagaccgcagatgaaaccgtagctcgggccttcgactttgtattgcaa
ttgcgtaaaacgcccattattgtgcaggaccgtcccgccttttttgtctctagagtggcc
agcacctactttatggagggcattttactgctcaaagaggggcaggggcctgcggccata
gaaaatgcgggtttgcaggcgggtatgcccatggggcccctagcctttgccgataatttg
ggatttaagtacattatttcggcagaagagcaggctgcccagcagctagatggccgctat
caggcctcgcccgctattgctgtattgcaagaaatgctggcccaagagcgctatggcaaa
gctcggaatgggggcttttataactacaaggaagagcccgtccgtttgtgggggcagctc
aaagagaactttcccttggcccaagagcaattgttgcccaaagatttgcaagaccgtctg
ctttttattcagtgcctagaggcggttcgctgtctagaggagggcgtcattcagaatagc
tatgatgccaacttaggaagtatttacggctggggctttgctccttttaaggggggcgtg
attcagtttatcaatgattatggtttgcgggaatttgtggctcgggcagaggtgttggcc
cagcgttttggtccccgcttcaagccttctgccagcttattagagatggccgaacaggat
actaattttctctaa

DBGET integrated database retrieval system