KEGG   Saprospira grandis: SGRA_2666Help
Entry
SGRA_2666         CDS       T01764                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sgn  Saprospira grandis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_2666 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGRA_2666 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SGRA_2666 (sucB)
Enzymes [BR:sgn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SGRA_2666 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2723604..2724866
Genome map
AA seq 420 aa AA seqDB search
MSIIELKVPVIGESVTEVTLSAWLKEDGAYVEQDEAICEFESDKATVEAPAEKAGKLIWV
AAEDDDIPIGGVYAKIDTSVSGGSSESTPEVKEEAPAQEEKTEEAAPQEDSYAAGHPSPA
ARKLMDENGLTAANIQGTGKDGRITKEDVLKAIANKQAAPKKEAAPKKEEPKTVAAPPVS
GAANFSREKRQEKMSRMRRTIASRLVYAKNETAMLTTFNEVDLTNIMKLRKTYQEDFVKK
YGIKLGFMSLFAKACAKVLMEMPDVNAQLTEDGKNLIYHDYADISIAISTPTGLVVPPVH
NVESLSFSDIEWKIKELAGKARSGKLTLDEMSGGTFTITNGGVFGSMMSTPIINPPQSAI
LGMHTIQQRPMAVDGEVKIRPMMYLALSYDHRVIDGSTSVTFLVKVKELLEDPTRLLLDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtattattgaactaaaagtacccgtaattggggaatcagttacagaggtgacgcta
tcggcctggctcaaggaagatggcgcctatgtagaacaagatgaggccatctgcgaattt
gaatcagataaggccaccgtagaagctcctgccgaaaaagcaggtaaacttatttgggtt
gctgccgaggatgatgatattccaatcggtggcgtttatgccaaaattgatacgagcgtt
tctggcggcagcagcgaatctactcctgaagtaaaggaggaagctcccgctcaagaagaa
aaaacagaggaggccgctcctcaagaggatagctatgcggctggacatccttctcccgct
gctcgcaaactcatggatgaaaatggccttactgctgccaatatccaaggcaccggcaaa
gatggtcgcatcaccaaagaagatgtactcaaggcgatagccaacaagcaagccgcgcct
aaaaaagaggccgctcccaaaaaagaagagcccaaaactgtggccgctcctcctgttagt
ggagccgctaactttagccgcgaaaaacgccaagagaagatgtcgcgcatgcgccgtact
atcgcttctcgcttggtctatgccaaaaatgaaacggccatgctcactaccttcaatgag
gtagacttgaccaatatcatgaagttgcgcaaaacttaccaagaggattttgtgaagaaa
tatggcatcaaactcggctttatgtcgctctttgccaaggcttgcgctaaggtccttatg
gaaatgcccgatgtgaacgctcaactcacagaagatggcaaaaacctcatttatcacgat
tatgccgatatttctatcgccatttctacgcccactggcctagtggtgcctcccgttcac
aatgtggagtcgctcagtttttctgatatcgagtggaagatcaaggagctagctggcaag
gcccgcagcggtaaattgaccttagacgaaatgagcggcggaaccttcactattaccaat
ggtggcgtttttggctcgatgatgagtacgcccattatcaaccccccacaatcggctatt
ttgggtatgcacaccatccagcagcgccccatggccgtagacggcgaggtcaaaatccgt
cccatgatgtatttggccctctcttatgaccaccgcgtgatcgacggtagcacttcggtg
accttcctcgtgaaagttaaagaattgctcgaagatcctactcgcttgttgctcgatctc
tag

DBGET integrated database retrieval system