KEGG   Saprospira grandis: SGRA_2671Help
Entry
SGRA_2671         CDS       T01764                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgn  Saprospira grandis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGRA_2671 (ruvA)
Enzymes [BR:sgn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SGRA_2671 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2728873..2729484
Genome map
AA seq 203 aa AA seqDB search
MIAYLHGKLVYKSPTELIMDVAGVGYRLHISLQTYQAVQALDQAKLLTHHLVKEDQEALY
GFATAEELQLFEQLISVSGVGANTARVLLSAMSAKEIRGAIIAENVAVLKSAKGIGPKSA
KRIILELKDKLLKESGAVSEAIAASIQGQTVGENPIRSEALDALLALGFNKIKAQKVLNK
ILKTEPEMQDVGQLIKLALAQMT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctacttgcatggtaagctcgtatataagagccctacagaattgattatggat
gttgctggcgtgggatatcgtcttcacatcagtttgcagacctatcaggcggtgcaagcc
ttggaccaggccaagctactcacgcatcatttggtaaaagaagatcaggaggccttatac
ggctttgctacagcggaggagctgcaactatttgagcagttgatttcggtatctggagtg
ggggccaatacggctcgggtcttattgtcggctatgtcggccaaagaaattcggggggca
attattgctgaaaacgtggcagtattgaagtcggccaagggaattggaccaaaatcggcc
aagcggatcattttggagctcaaagacaaattgctcaaagaaagcggcgcggtgagcgag
gccattgcggcttccattcagggccaaacggtgggggagaaccctattcgttcggaggca
ttggatgcgcttttggccttgggctttaataaaataaaggcacaaaaagtgctaaacaaa
attctcaaaacggagccagagatgcaagatgtggggcaactcatcaagttagccttggct
caaatgacttaa

DBGET integrated database retrieval system