KEGG   Saprospira grandis: SGRA_2992Help
Entry
SGRA_2992         CDS       T01764                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgn  Saprospira grandis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_2992 (tpiA)
   01230 Biosynthesis of amino acids
    SGRA_2992 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRA_2992 (tpiA)
   00051 Fructose and mannose metabolism
    SGRA_2992 (tpiA)
   00562 Inositol phosphate metabolism
    SGRA_2992 (tpiA)
Enzymes [BR:sgn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGRA_2992 (tpiA)
Exosome [BR:sgn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGRA_2992 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGRA_2992 (tpiA)
  Exosomal proteins of melanoma cells
   SGRA_2992 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3079111..3079884)
Genome map
AA seq 257 aa AA seqDB search
MKAKSLVVANWKMNKSYVPGIMLLNQIISTLDPLPEGKEMVICPPYIHLQTAQTLAKDRF
DVYIGAQNCHVQKEGAYTGEISAPMLADLGIKYVILGHSERRRDFAEDGKMLTEKVKQAL
RQGLQPIYCFGEPWPVRKEGQAQAFVEQQLQEVLGQLDAQQMERIVLAYEPIWAIGTGQT
ASPAEAEEMHAFIRAYLAKQFSEDLAQKTTILYGGSCKPSNAAALFAQPNINGALVGGAS
LDAEDFLAIVEAGRKEL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaagtcattagtggtagccaactggaagatgaataaatcttatgttccgggg
atcatgttactcaatcagattatttcgaccctagatcctttgcccgagggcaaagaaatg
gtgatttgtccgccctacattcatttgcagacggcccagaccttggccaaagatcgtttt
gatgtatatattggggcacagaactgccatgttcagaaagagggcgcctatacgggagag
atttcggcgcctatgttggctgatttaggtataaagtatgtgattttgggccattctgag
cgaagaagagactttgcggaagatggcaaaatgctaacggagaaggtcaagcaagctttg
cgtcagggcttgcagccaatttattgttttggagagccttggccggttcggaaggagggc
caagcccaagcatttgtagagcagcaattgcaggaagttttgggacagctagatgcccag
cagatggagcggattgttttggcctatgagccgatttgggccattggcacggggcagacg
gctagtccggcagaggccgaagaaatgcacgcttttattcgggcttatttggccaaacaa
ttttctgaggacttggcccagaaaacgactattttgtatggtggaagttgcaagcccagc
aatgcggcagctctttttgcccagcccaacatcaatggggctttggtgggcggtgcctct
ttggatgccgaagactttttggccattgtagaagctggacgcaaggaactataa

DBGET integrated database retrieval system