KEGG   Saprospira grandis: SGRA_2992Help
Entry
SGRA_2992         CDS       T01764                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgn  Saprospira grandis
Pathway
sgn00010  Glycolysis / Gluconeogenesis
sgn00051  Fructose and mannose metabolism
sgn00562  Inositol phosphate metabolism
sgn01100  Metabolic pathways
sgn01110  Biosynthesis of secondary metabolites
sgn01120  Microbial metabolism in diverse environments
sgn01130  Biosynthesis of antibiotics
sgn01200  Carbon metabolism
sgn01230  Biosynthesis of amino acids
Module
sgn_M00002  Glycolysis, core module involving three-carbon compounds
sgn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRA_2992 (tpiA)
   00051 Fructose and mannose metabolism
    SGRA_2992 (tpiA)
   00562 Inositol phosphate metabolism
    SGRA_2992 (tpiA)
Enzymes [BR:sgn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGRA_2992 (tpiA)
Exosome [BR:sgn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGRA_2992 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGRA_2992 (tpiA)
  Exosomal proteins of melanoma cells
   SGRA_2992 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Oxidored_nitro PRP4
Motif
Other DBs
NCBI-ProteinID: AFC25720
UniProt: H6KZE4
Position
complement(3079111..3079884)
Genome map
AA seq 257 aa AA seqDB search
MKAKSLVVANWKMNKSYVPGIMLLNQIISTLDPLPEGKEMVICPPYIHLQTAQTLAKDRF
DVYIGAQNCHVQKEGAYTGEISAPMLADLGIKYVILGHSERRRDFAEDGKMLTEKVKQAL
RQGLQPIYCFGEPWPVRKEGQAQAFVEQQLQEVLGQLDAQQMERIVLAYEPIWAIGTGQT
ASPAEAEEMHAFIRAYLAKQFSEDLAQKTTILYGGSCKPSNAAALFAQPNINGALVGGAS
LDAEDFLAIVEAGRKEL
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctaagtcattagtggtagccaactggaagatgaataaatcttatgttccgggg
atcatgttactcaatcagattatttcgaccctagatcctttgcccgagggcaaagaaatg
gtgatttgtccgccctacattcatttgcagacggcccagaccttggccaaagatcgtttt
gatgtatatattggggcacagaactgccatgttcagaaagagggcgcctatacgggagag
atttcggcgcctatgttggctgatttaggtataaagtatgtgattttgggccattctgag
cgaagaagagactttgcggaagatggcaaaatgctaacggagaaggtcaagcaagctttg
cgtcagggcttgcagccaatttattgttttggagagccttggccggttcggaaggagggc
caagcccaagcatttgtagagcagcaattgcaggaagttttgggacagctagatgcccag
cagatggagcggattgttttggcctatgagccgatttgggccattggcacggggcagacg
gctagtccggcagaggccgaagaaatgcacgcttttattcgggcttatttggccaaacaa
ttttctgaggacttggcccagaaaacgactattttgtatggtggaagttgcaagcccagc
aatgcggcagctctttttgcccagcccaacatcaatggggctttggtgggcggtgcctct
ttggatgccgaagactttttggccattgtagaagctggacgcaaggaactataa

DBGET integrated database retrieval system