KEGG   Saprospira grandis: SGRA_3223Help
Entry
SGRA_3223         CDS       T01764                                 

Gene name
cheB
Definition
protein-glutamate methylesterase, two-component response regulator, chemotaxis (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sgn  Saprospira grandis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sgn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sgn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3324860..3325909
Genome map
AA seq 349 aa AA seqDB search
MTKLPNKPKRILLAEDSAVMRQLIRSWLGNNRGYDIVGQARDGKEAAEMAAKFQPDLVLM
DLFMGDYDGLYGVEQIMKSNCPCPILLLSAASQGEELLLKALAAGATDVLAKPSLRDGNL
QHFGLELDQKIKAALATNLAQKPQAFASQAKHSFSTDLPYEMLLLGASTGGPATLEFILA
QLPENWPLPIVIAQHMPQAFLPAFASRLQKLSKLKVSLAQNGERPKPNQVYLAPGDHHLL
LRGIPNDYLFAWSQRTHPSYNYPSVDALFESAAEVIGKTLLGVLLTGMGSDGAKGLLAIK
EAGGFTINQDEASSSIYGMPRAAQEIGASRRELSLSAIPPFLVQLLDME
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaccgaataagcccaaacgcatcttattggccgaagattcggctgtgatg
cgccagctgattcgttcttggttgggcaataatcgaggctatgatattgtgggccaagcc
agagatggtaaggaggccgcagaaatggccgccaaatttcaacctgatttggtcctgatg
gacctttttatgggcgattacgacggcctttatggggtagagcaaattatgaaatcaaat
tgcccttgtcccattttgttgctctctgcagccagccaaggcgaagagcttttgctcaaa
gccttggcggctggggccaccgatgtactggccaagccctctttgcgcgatggcaatttg
cagcattttggtctagagttggaccaaaaaattaaggcggccctagccactaatttggcc
caaaaaccacaggcttttgctagccaagccaaacactctttttcaacagatttgccctac
gaaatgctattgttgggcgcttctactggcggtcccgccaccctagagtttattttggcc
caattgcccgaaaattggccgctgcctattgttattgcccagcatatgccgcaggccttt
ttgcccgcttttgccagccgcctacaaaagttgtcgaaactaaaggtgagtctggcccaa
aatggagaacgcccaaaacccaatcaggtctatttggcccctggagatcatcatttgctc
ttgcggggaattcctaatgactacctttttgcttggagccaaagaacgcatccttcctat
aattacccttctgtagacgccctttttgagtcggccgcagaggtgattggaaaaactctt
ttgggggttttgctcacgggaatggggtccgatggggccaaaggcttattggccattaag
gaggctggcggctttacgatcaaccaagatgaagctagctctagcatttatggaatgccc
cgagcggctcaagaaataggcgccagccgaagggagttgtctctctcggctattccgccc
tttttggtccaattactagatatggagtag

DBGET integrated database retrieval system