KEGG   Saprospira grandis: SGRA_3256Help
Entry
SGRA_3256         CDS       T01764                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sgn  Saprospira grandis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sgn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3360405..3361028
Genome map
AA seq 207 aa AA seqDB search
MNAVILVDLQYDFCQHGALEVPDANAVIPVANSLMPHFELVIATQDWHPANHKSFAANHL
FRQPGQVIDLNGLAQILWPIHCVQGSYGAELVDELDQSQITKIFQKGTDIEIDSYSGFFD
NGHRKATGLGDYLKEKGVTTVFVLGLALDYCVKFTALDAQALGFKTYLVQDACRAVNMQA
EDGKNAIAELKAKGIEIVDSQDVVNLV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagttatcttagtagatttacaatacgatttttgccaacatggcgccctagag
gtccccgatgccaatgccgtgatccctgtcgccaatagcctaatgcctcattttgagctg
gtgatagctacccaagattggcatcccgccaaccacaaaagctttgcagccaaccacctt
tttcgacagcctgggcaagtaattgacctcaatggcttagcgcaaatcctttggcccatt
cactgtgtgcaaggaagctatggggccgaattggtggacgaattggaccaaagccaaatt
accaagatcttccagaaaggaactgatatagaaattgatagctatagtggcttttttgat
aatggccatagaaaagccaccggcctaggcgattatttgaaagaaaaaggcgtcacaacc
gtttttgtgctcggccttgcgctagattattgcgtcaagtttaccgcactagatgctcag
gccctaggctttaaaacttatttggtccaagatgcttgtagagcggtaaatatgcaagca
gaagatggaaaaaatgcaattgccgagctaaaagcaaaaggcattgaaattgttgatagt
caagatgttgttaatttggtgtag

DBGET integrated database retrieval system