KEGG   Saprospira grandis: SGRA_3448Help
Entry
SGRA_3448         CDS       T01764                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme a synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sgn  Saprospira grandis
Pathway
sgn00010  Glycolysis / Gluconeogenesis
sgn00620  Pyruvate metabolism
sgn00640  Propanoate metabolism
sgn00680  Methane metabolism
sgn01100  Metabolic pathways
sgn01110  Biosynthesis of secondary metabolites
sgn01120  Microbial metabolism in diverse environments
sgn01130  Biosynthesis of antibiotics
sgn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGRA_3448 (acs)
   00620 Pyruvate metabolism
    SGRA_3448 (acs)
   00640 Propanoate metabolism
    SGRA_3448 (acs)
  Energy metabolism
   00680 Methane metabolism
    SGRA_3448 (acs)
Enzymes [BR:sgn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SGRA_3448 (acs)
Lipid biosynthesis proteins [BR:sgn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SGRA_3448 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFC26173
UniProt: H6L1U5
Position
3559208..3561109
Genome map
AA seq 633 aa AA seqDB search
MEHQINSWEEYEKVYAESVANPEAFWANVAESFSWKKKWDNVLSWNFDGPDVKWFEGAEL
NITENCLDRHLAERGDQTAIIWEPNGPKTPEIRLTYKELHAKVCQMANVLKSYGVVKGDR
VCLYMPMIPELAIATLACARIGAIHSVVFAGFSANALADRINDAQAKVVLTADGSLRGAK
VIPLKDIADEALSHCPCVETVLVAKRSDKFCHMQAGRDVWLGEAMDAASTDCPAETMSAE
DMLFILYTSGSTGKPKGVVHTTAGYMVYAYYSFVNVFQYQQNDIYWCTADIGWITGHTYI
VYGPLLAGASSVMFEGVPTWPDAGRFWAICDKYQVNQFYTAPTAIRALMAKGLEYVAPYR
LNSLKVLGSVGEPINEEAWQWYNKYIGKNQCPIVDTWWQTETGGIMISPLPNITPLKPTY
ATRPLPGIQPCLLDAEGNELAENDVEGLLAVKFPWPSMLRTTYGDHDRCKQVYFSMFKDK
YFTGDGAKRDADGNYRIIGRVDDVINVSGHRLGTAELENVINEHDIIVESAVVGYPHEIK
GQGIFAFVIVQEACSQEALEAELKELINTEIGPIAKPDRIQVVSGLPKTRSGKIMRRILR
KIASGDVSNLGDTSTLLDPSVVEEIKEAVLGTA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccaaatcaatagctgggaagaatacgaaaaagtatatgcagaaagcgtagct
aatccagaggctttctgggccaatgtagccgaaagtttttcatggaaaaagaaatgggat
aatgtcctttcttggaattttgatggccccgatgtcaaatggtttgagggggccgaattg
aatattacggaaaactgcctagaccgtcatttggccgaaagaggcgatcagacggctatt
atttgggagcccaacggacccaaaacccctgaaattcgcttgacttataaggagttgcat
gccaaggtttgccagatggccaatgtgctcaagtcttatggcgtagtgaagggcgaccga
gtttgtttgtacatgccgatgattccagaattggctattgccactttggcttgtgcccgt
attggggccattcactcggtggtttttgctggtttttcggccaatgctttagccgaccgc
atcaatgatgcgcaggccaaggtagtgcttactgctgatggatctttgcgtggggccaaa
gtgattcccttaaaagatattgccgatgaggcgctcagtcattgcccttgcgtagaaacc
gttttggtggctaagcgcagcgataagttttgccatatgcaagcgggccgagatgtttgg
ttgggagaggcgatggatgcggctagtacggactgtcccgccgaaacgatgagcgcagaa
gatatgctcttcattctctatacttcgggctctacgggtaagcccaaaggggtggtgcac
actactgcgggctatatggtctatgcctattatagctttgtgaacgtttttcagtatcag
cagaatgatatttattggtgtacggctgatattggctggattacgggccacacttacatt
gtttatgggcctttgttggctggtgccagctcggtaatgtttgagggcgtgcctacttgg
cccgatgctggccgtttttgggccatttgtgataaatatcaagtaaatcagttctacacg
gcccccacggccatccgcgctttgatggccaaaggcctagaatatgtagcgccttaccgt
ctgaactcgctcaaggtcttgggttctgttggcgagcccatcaatgaagaggcttggcag
tggtacaataagtatattggtaagaatcaatgccctattgtagatacttggtggcaaacg
gaaaccggcgggatcatgatttctcctctacccaatattacgcccctcaaacccacctat
gccactcgtcccttgccgggtattcagccttgtttgctagatgcagagggcaatgaattg
gctgaaaatgatgtagagggtttgttggcggttaagtttccttggccctcaatgttgcgc
accacttatggcgatcacgaccgctgtaaacaggtctatttctcgatgtttaaggacaaa
tattttacgggagatggcgccaaacgcgatgccgatggcaattatcggatcattggtcgg
gtagatgatgtgattaacgtttcgggccaccgtttgggcaccgccgagctcgaaaatgtg
atcaatgagcatgatattatcgtagaatcggctgtggtaggctatccgcatgagattaaa
ggccagggcatttttgcctttgtgattgttcaggaagcatgcagccaagaggctttggag
gccgagctcaaagaacttatcaataccgaaattggtcctattgccaaacccgaccgcatt
caggtggtttcgggccttcctaaaacccgctcgggtaaaattatgcgtcgtattctgcgc
aaaattgctagcggagacgtgagtaacctaggagatacctccactttacttgatccctct
gtagtggaggaaattaaggaggctgtgcttggaacagcataa

DBGET integrated database retrieval system