KEGG   Saprospira grandis: SGRA_3567Help
Entry
SGRA_3567         CDS       T01764                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sgn  Saprospira grandis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sgn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3669545..3670864)
Genome map
AA seq 439 aa AA seqDB search
MSKSASFLVEGNAQLSGSIRPQGAKNEALQVICAVLLTAEKVSISNVPNIRDVVRLIELL
QGLGVAVEKVSDNRYTFKAENIDLDYLQTQEFVQKASSIRGSVMIMGPLLARFGKAVLPK
PGGDKIGRRRMDTHLNGLQYLNVDYRYVREEHIFLLETEGLKGNFILMEEISVTGTANVL
MAASMAKGVTTIYNAACEPYLQQLAKMLNSMGARITGLGSNRLVVEGVDQLYGTGHRCLP
DMIEIGSFIGLAAMTKSAITIEQARVDMLGNILPTFERFGIQLEIQGDDIHVPAQDIYEI
QNFIDGSVLNVYDSPWPGFPPDLMSILLVVATQARGSVLIHQKMFESRLFFVDKLIDMGA
QIILCDPHRATVIGLERKSQLKGIEMTSPDIRAGVSLLIAALSAKGNSRIHQIHQIDRGY
ERIDERLNALGANIQRIEQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatcagcatcttttttagtagagggcaatgcccaactatcgggcagcattcgc
ccacaaggcgccaaaaatgaggccctgcaagttatttgtgccgtattgctgacggccgaa
aaagtaagcatcagtaatgttccgaatattcgggatgtggtccgtttgattgagcttttg
caaggcttgggcgtagcggtagaaaaagtgagcgacaaccgctatacctttaaagccgaa
aacattgatctggattatctgcagacccaagaatttgtgcaaaaagccagtagtattcgg
ggttctgtgatgattatgggcccccttttggcccgttttggcaaggcggttttgcccaaa
cctggaggcgataaaattggtcgccgccgtatggatacccacctcaatggcctacaatat
ttgaatgtagactaccgctatgtgcgggaggagcatatctttttgctcgaaaccgagggc
ctcaaaggcaatttcatcctgatggaagagatttcggtaacgggtacggccaatgtcctt
atggccgctagtatggccaaaggcgtgacgaccatttacaatgccgcctgcgagccttat
ttgcagcaattggccaaaatgctcaatagtatgggggccagaattacgggcttgggctct
aaccgcctagtggtagagggggtggaccaactttatggtacgggccaccgctgcctaccc
gatatgattgaaattgggagctttattggcctagccgccatgaccaaatcggccattacg
attgagcaagctcgggtagatatgttgggtaatattttgcccacttttgagcgctttggc
atccaactcgaaatccaaggcgatgatattcatgtgcccgcccaagatatttacgagatc
caaaactttattgatggctcggtcctcaatgtctatgactcgccctggcccggctttccg
cccgacctgatgagtattttgttggtggtggccacccaagccagaggtagcgtgctcatt
catcaaaaaatgtttgaaagccgcctcttttttgtcgataaactcattgatatgggcgct
cagattattctttgcgacccgcatcgggcaaccgtaattggcctagagcgaaaatctcag
ctcaaaggcattgaaatgacctctcccgatattcgggcgggcgtttctttgctcattgcc
gccctttcggccaaaggaaatagccgaattcatcaaattcatcaaattgaccgaggctat
gagcggattgatgagcgtttgaatgcccttggggccaatattcaacgcatcgaacaataa

DBGET integrated database retrieval system