KEGG   Saprospira grandis: SGRA_3699Help
Entry
SGRA_3699         CDS       T01764                                 

Gene name
sucB
Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sgn  Saprospira grandis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGRA_3699 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SGRA_3699 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SGRA_3699 (sucB)
Enzymes [BR:sgn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SGRA_3699 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3813701..3815026
Genome map
AA seq 441 aa AA seqDB search
MAKVELIMPKLGESIIEATILSWEKEVGESVELDENVLTIATDKVDTEVPSPVEGVLLEI
LHPDGATVAVGAPIAIIETEAEGVEASPAVAEAPQAKEESSAAPQPETAAVVATDFSQSD
RFYSPLVKSIAKEEGIALEELDNISGTGQNGRVTKHDVLAYLENRKKAPQAAAPVKKEAP
KAVAPANNGQQMAVQQFNLPPVDTSGNVEIIEMDRMRKLIADHMVMSKHVSPHVTSFVEV
DVTNIVQWRKKAKAVYAEKYGEKITFTPIFVEAVTKALQDYPMVNIAVKGNQIVRYKDIN
IGMAAALPTGNLIVPVIKNADMLNLVGLTKKVNDLANRARGNKLKPEEIKGGTFTLTNVG
TFGNVMGTPIINQPQVAILAVGAIRKKPAVIETPTGDTIGIRHMMFLSLSYDHRVVDGML
GGSFLRRVGDYLEAFDLNRDI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttgagttaatcatgcccaaattgggagaaagtatcattgaggccactatc
ttatcttgggaaaaagaggtaggcgaaagcgtagagctagacgaaaacgtcttaacgatt
gccaccgataaggtggatacagaagtgccttctcctgtagaaggggtcttgctggaaatt
ctgcatcccgatggcgccacagtggccgtgggagccccaattgctattattgaaacagaa
gcggagggcgttgaagcttctcctgctgtggcggaagcgcctcaggccaaagaagaaagc
agtgcagctcctcagccagagacggcggctgttgtggctacagattttagccaatcggat
cgtttttactctcctttggtgaaaagcattgctaaggaagaaggtattgccttagaagaa
ttggacaacattagcggaacgggccaaaatggccgagtgacgaagcatgatgttttggcc
tatttggaaaatcgcaaaaaagcgcctcaagcggcggctcctgtgaaaaaagaggctccc
aaagcggtagctcctgccaataatgggcaacaaatggcggtacagcagttcaatttgccc
ccagtagacacttctggaaatgtagaaattattgagatggaccgcatgcgcaagctcatt
gcggatcatatggtcatgtctaagcatgtttctccgcatgtgacttcttttgtagaagta
gatgtaaccaatatcgtacaatggcgcaaaaaggccaaggccgtttatgccgaaaaatat
ggcgagaaaattacctttacgcccatttttgtagaagccgtaaccaaggccctacaagat
taccccatggtgaatatagccgtaaaagggaaccaaattgttcgctataaagatatcaat
attggtatggcggcagctttgcccactggcaacctcattgtgcccgtgattaagaatgcc
gatatgctcaatttggtgggcttgaccaaaaaggtaaatgatttggctaatcgcgctaga
ggaaataaactcaagcccgaagaaattaaaggcggtacctttactttgaccaatgtcggt
acttttggtaatgtaatgggcacccccattattaaccaacctcaggtggctattttggcc
gtgggcgcaattcgcaaaaagcccgcagtaattgaaacccctactggagataccattggt
attcgccacatgatgttcctctcgctatcttatgaccaccgagtggtggatggtatgctt
ggcggttctttccttcgtcgtgtaggagattatctagaagcttttgacctcaatagagat
atctag

DBGET integrated database retrieval system