KEGG   Saprospira grandis: SGRA_3703Help
Entry
SGRA_3703         CDS       T01764                                 

Gene name
recD
Definition
putative exodeoxyribonuclease V (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgn  Saprospira grandis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGRA_3703 (recD)
Enzymes [BR:sgn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SGRA_3703 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3815974..3818262)
Genome map
AA seq 762 aa AA seqDB search
MDAISQRLKGQLTHIIYRNEENGYTVARFQPDDGGKQTVVVGSLLGVEKGEKLICQGYWT
NNKRHGKQFQVEQFEQQLPQSPEDIERYLSSGQIRGVGPTFAKRIVAKFGKETLDVIENS
PEKLLDVRGISQNKLDLIISSWQEQQKARSLIIFLQKNGISPAFAQKIYKKYGSESIAKI
KQNPYCLANDIEGIGFTKADEIAKKMGLQQEDPKRVSAALLYLLQELAGQGHSCYPLQSF
LQEGGQMLALGQEQLQGPLAQLKDKKEVFVERFWDESKGQDERLIWSKSLYYQEKDIIEQ
LDRLNKYPQTWAEDIDIESELELAQKNTAIDLAPEQLEAVRRSLSHKLHIITGGPGTGKS
TITKIILNILSRHSDTICLAAPTGRAAKRLAEVTGQEASTIHSLLSIGIGAYYNQHIRNM
EELDCDVLIVDEASMIDTTLMAILLHALPHHAKLILVGDVDQLPSVGPGNVLDDLMGSDK
LAVTRLKEIFRQAANSKIVRNAHKINQGIFPDIQTEADADFFFIPKANAAEAAQMIPELM
AKRLPKRYSFDAKKDIQLLCPIHKGELGTRALNKSLQKALNPNGPKKDKIERGEQVFYLG
DKVMQLKNDYEKGVYNGDIGYIRKITPAEKTFMVEMDGKTMIEYQYQDLQNMDLAYAVSV
HKYQGSEAPCILMPIHESQYSLLFRNLVYTAITRGKRLVVLIGSKKALHIAVRNQRMRKR
YSGLLWLLQDPSEKKLPAIQIAPLPNSPEYPDWLERHFPDEV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgatcagccagcgcctaaaagggcaactgacacatattatctaccgaaatgag
gaaaatggctatacagtagctcgttttcagccagatgatggcggaaaacaaacggtggtg
gtcggtagtcttttgggggtagaaaaaggcgaaaaactaatttgtcagggctattggacc
aataataaacggcatggcaaacagtttcaggtagagcaatttgaacaacaactgccccaa
agtcccgaagatattgagcgctatttgagctcgggccaaattcgaggcgtcggcccaact
tttgccaagcgaattgtggccaaatttggtaaggaaacccttgatgttatcgaaaattcg
ccagaaaaactgctggatgttcgagggattagccaaaataaactggacctcattattagc
tcttggcaggagcaacaaaaggcccgtagcctcattattttcttgcagaagaatggaatt
tctccagcttttgcccaaaaaatatacaaaaaatacggctcggaaagcattgctaaaatt
aagcaaaatccttattgcctcgccaatgatattgaagggatcggctttacaaaagcagat
gaaatagcaaagaaaatgggcctgcaacaagaggaccccaaacgagtttcggccgctttg
ctctaccttttgcaagagctagccggccaaggacatagctgctatccacttcaaagtttt
ttgcaagaaggcggccaaatgctggccctaggacaagagcaattgcaggggcccttggcc
caactcaaagataaaaaggaggtttttgtcgaaagattttgggatgaaagtaagggacag
gatgaacgcctgatttggagcaaaagcctctattatcaagaaaaagatattattgagcag
ctcgatcgcctgaataaatacccccaaacttgggccgaagacattgatattgagtcagaa
ctggaattggcccaaaaaaatacggccattgacctagcccccgaacaactagaggccgtc
cgccgaagcctgagccataagttacatattatcacggggggacccgggacgggcaaaagt
acaattaccaaaattatcctcaatattcttagccgacatagcgatacgatctgcttggcc
gcgcccaccggccgagccgcaaaacgcctggccgaagtgaccggtcaggaggctagcacg
atccattctctgctttcgattggaattggcgcctactacaaccagcatattcgcaatatg
gaagagctggattgtgacgtactgattgtggatgaggccagtatgattgatactaccctg
atggcgattttgctgcatgccctgccgcatcatgccaaactcattttggtgggcgatgtg
gaccagctccctagcgtggggcccggcaatgttttagatgatttgatgggctcggataaa
ctagccgtgacccgcctcaaagaaatttttcgacaagcggctaactcgaaaattgtacgc
aatgcgcacaaaatcaatcaaggtatttttcccgatattcagaccgaagccgatgccgac
ttttttttcatccctaaagccaatgccgcagaggccgcccagatgattccggaacttatg
gccaaacgactgcccaaacgctatagttttgatgcaaaaaaggatattcagctcctctgc
cctatccataaaggcgagctaggcacccgagctcttaataaaagcctgcaaaaagccctc
aatcccaatgggcccaaaaaggacaaaattgaaaggggcgaacaggttttttatctgggc
gataaggtcatgcagctaaaaaatgactacgaaaaaggcgtttataatggcgatattggc
tatatccgcaaaattactcccgccgaaaagacgtttatggtcgaaatggatggaaaaacc
atgattgaataccaatatcaggacctccaaaatatggacctcgcctatgccgttagtgta
cataagtaccaagggagcgaggcgccctgcatcctgatgcccatacatgagtctcaatat
agcctgcttttccgcaatttggtttataccgcaatcacccgtggcaagcggttggtggtc
cttatcggcagcaaaaaagccctgcatattgccgtgcgcaaccaaagaatgcgcaaacgc
tattcgggcttgctttggttgttgcaagaccctagcgaaaaaaaactacctgctattcaa
attgcccccctgcccaatagtcccgaatatcccgactggttagagcggcattttcccgat
gaagtctaa

DBGET integrated database retrieval system