KEGG   Saprospira grandis: SGRA_3935Help
Entry
SGRA_3935         CDS       T01764                                 

Definition
peroxiredoxin (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sgn  Saprospira grandis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sgn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SGRA_3935
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SGRA_3935
Enzymes [BR:sgn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SGRA_3935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4052443..4053012)
Genome map
AA seq 189 aa AA seqDB search
MKYLFVSGLVFFGLAFSFLAFKPCNDMAKIYDFKVETIDGEEIQLNQYKGKTLLIVNVAS
KCGLTPQYEELQALYEEYKDQGLLILGFPANNFMGQEPGSNEEIKSFCRLNYGVGFPMFA
KISVKGKDIHPLYSYLTQKSENGVLDAKVRWNFQKFLISPEGKLLQSFAPREKVTEKEVR
QAIVAALPQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacctatttgtttcgggcctagtattttttggcctcgcttttagttttctggca
ttcaaaccctgcaacgatatggcaaagatttatgattttaaggtagaaaccattgacgga
gaagagattcagctcaaccaatataagggcaaaaccctactgattgtcaatgtggctagc
aaatgcggcctcactcctcagtatgaagagctacaggcgctctatgaggaatacaaagat
caagggctcctcattttgggctttcccgccaataactttatgggccaagaacccggaagt
aatgaggaaattaaaagtttttgtcgcctaaattatggggttggctttcccatgtttgcc
aaaatatcggtcaagggcaaagatattcaccctttgtatagctacctcacgcaaaagtca
gaaaacggggtcctcgatgctaaagtgcgctggaacttccaaaagttcctcatttcgccg
gaaggcaagctgctgcagtcttttgcccctagagaaaaagtaaccgaaaaagaggtgcgc
caagcaattgttgccgcccttccccaataa

DBGET integrated database retrieval system