KEGG   Saprospira grandis: SGRA_4195Help
Entry
SGRA_4195         CDS       T01764                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sgn  Saprospira grandis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4314899..4315891
Genome map
AA seq 330 aa AA seqDB search
MRYLPLLFLSLLLLSSCQKEEKSYALDLPPGFPEVDLPEDNLPTPLRVELGKRLFFDPIL
SRDSSISCGSCHFRRLGFADDKVISPGIEGRLGFRNAPILTNLIYRENFFFDGGVPNLEL
QVVAPVEDENEMDFHLGGVVERLARHPEYAALLEKAYPGKPLTFAFTRAIASYERTLLTG
QSAFDRYYYQGDSNALDSQEKRGWQLFQDKGCRDCHSGPNFSNEEFINIGLYADYDYNGD
SGRRRVTALDSDIGKFKVPSLRNIALTAPYMHDGSMQSLEEVVDFFASGGEAHFNKSPQM
QAFALSAQEKADLIAFLESLTDWEFVQGTD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacctccccctcttattcctgagcctactgctgctgagcagctgccaaaaagaa
gaaaaaagctatgccctagatctgccgcccggttttccagaggtagatctgcctgaggat
aatctgcccacccccttgagggtagaattgggcaagcggctattttttgaccccattttg
tctagagattctagcatttcttgtggctcttgccactttagaagattgggctttgccgac
gataaggtaatttcgccaggtatagaggggcgcttgggctttcgcaatgcgcctattttg
accaacctcatttatcgagaaaactttttctttgatgggggtgtccccaacctagagcta
caagtggtggcccctgtagaagatgaaaacgagatggattttcatttgggaggcgtagtg
gagcggctcgctcgacatcctgaatatgccgcacttttagaaaaggcttatccaggcaaa
ccccttacttttgcctttacccgtgctattgccagctacgaaaggacattactcactggc
caatctgcctttgatcgctactattatcagggcgatagcaatgccttggacagccaagaa
aaaagaggttggcagctttttcaggacaaaggctgtagagactgccatagcggccccaac
ttctccaatgaagaatttatcaatattggcctttatgccgattatgactacaatggggac
tccggccgccgaagagtgaccgccttagatagcgatattggcaaatttaaggtccctagt
cttcgcaatattgcccttacggccccctatatgcacgatggcagcatgcaaagccttgag
gaagtggtggatttctttgcctctggcggagaagcccactttaataaaagtccccaaatg
caggcctttgcgctatcggcccaagaaaaagccgatttaatcgcctttttggaaagcttg
accgattgggagtttgtgcagggaacagactaa

DBGET integrated database retrieval system