KEGG   Streptococcus gordonii: SGO_0043Help
Entry
SGO_0043          CDS       T00594                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sgo  Streptococcus gordonii
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGO_0043
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SGO_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
45352..47130
Genome map
AA seq 592 aa AA seqDB search
MSDNFLLNQKPFKILSGAIHYFRVHPDDWHHSLYNLKALGFNTVETYVPWNVHEPEKGRF
NFQGQLDLERFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTEDMRIRSSDPRFIEA
VAAYYDELLPRLTPRLLDRGGNILMMQVENEYGSYGEDKAYLRAVRDLMIERGVTCPLFT
SDGPWRATLEAGTLIDEDLLVTGNFGSRADENFASMKEFFQEHDKKWPLMCMEFWDGWFN
RWKEPIITRDPEELAEAVHEVLKQGSINLYMFHGGTNFGFMNGCSARGTIDLPQVTSYDY
DALLNEAGNPTPKYFAVQKMLKTYYPEFPQMEPLVKGNFEQKNIPLSDKVSLFETLADLA
EPVQSLYPKKMEELGQNYGYLLYHTEADWDADQEKIRIIDGRDRMQLFIDQEHIATQYQT
EIGADIFVNRQVKTKHSIDILVENMGRVNYGHKLLADTQRKGIRTGICKDLHFMLDWQHY
CLTLDQPEKIDFSKEWYPGHPAFYAFDFNLEMKALKDTYLDLTDFGKGVAFVNGVNIGRF
WNVGPTLSLYIPHGFLQEGANRIIIFETEGEFKDSIHLVNQPTFKNIKGENL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgataattttctactaaatcagaagccatttaagattttatcgggtgcaatccac
tacttccgagtgcatccggatgactggcatcattcgctttacaacttaaaagctttagga
tttaatacggttgagacttacgttccttggaatgtacatgagcccgagaagggaaggttc
aattttcaaggacaattggatttagaaagattcttgcaaatagctcaagacttaggactt
tacgctattgttcgaccgtcgcctttcatctgtgcggagtgggagtttggtggtttacca
gcttggcttttgacagaagacatgaggattcgttcatctgatcccaggtttattgaggct
gtagcagcttactacgatgaactgcttcctcgcttaacacctagattattggatcggggt
ggcaatattctcatgatgcaggttgaaaatgagtatggttcctatggtgaggataaagct
tatctcagagctgtcagagacctaatgatagagcgaggcgtaacctgtccactctttaca
tcagatggaccctggcgagcaactttagaggcaggcacactgattgatgaggatttgttg
gttactggaaactttggctctcgagcagatgaaaattttgcttcgatgaaagaatttttc
caagagcacgacaagaagtggccactcatgtgtatggaattttgggacggctggtttaat
cgttggaaggaacctattattacaagggatcctgaagagttggcagaagctgttcatgag
gttctcaagcaaggttcgatcaatctttatatgtttcatgggggaaccaactttggtttc
atgaatggttgttcagcgcgtggaacaattgatctcccgcaagtcacttcctatgactac
gatgccttgctaaatgaagctggaaatccaacacctaagtattttgcagttcaaaagatg
ttaaagacttattatccagaattcccacaaatggaacctctggtgaaaggcaattttgaa
caaaaaaatattcccttgagcgacaaggttagtttgtttgaaactttggcggatttggca
gagcctgttcaaagtctctatcctaaaaagatggaggagttaggtcagaactacggttat
ctactctatcatacagaagctgactgggatgcagatcaagaaaagattcgtattattgac
ggtcgcgatcggatgcaactttttattgaccaagaacatattgctacccaatatcaaact
gaaattggtgcagatatctttgtcaatagacaggtcaaaacgaagcatagtattgacatc
ctcgtagaaaatatgggtcgagtcaactacggccataaactcttggcagatactcagaga
aaaggtatccgaacagggatctgcaaggacttacacttcatgctagattggcaacattac
tgcctcactttagatcaacctgaaaagattgacttttcaaaagaatggtacccggggcat
ccagctttctatgcctttgattttaacctagaaatgaaagcgcttaaagatacctatctt
gatttgacagactttgggaaaggcgtcgcttttgtcaatggagtcaatattgggcgtttc
tggaatgtcgggccaaccttatctctttatattcctcatggctttctacaggaaggagca
aaccgtatcattatttttgagacagaaggggaatttaaagattctattcatcttgttaac
caacctacatttaaaaatataaagggggaaaatttatga

DBGET integrated database retrieval system