KEGG   Streptococcus gordonii: SGO_0105Help
Entry
SGO_0105          CDS       T00594                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sgo  Streptococcus gordonii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
107633..109183
Genome map
AA seq 516 aa AA seqDB search
MKERQSGVLMHISSLPGKYGIGSFGKSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDLDLLIKEGLLQESDLDGVDFGSDPKAVDYAKIFEARRPLLEKAVKNFL
QSSDLKAYKKFVADNANWLDLYVDYMAIKEHFDLAAWTEWSDEDIRLRKPDALADYRERL
SEQMEYHRVTQYFFFQQWLALKDYANKHHIDIVGDMPIYVAADSADVWAQPHFFKTDAVG
KPTCVAGCPPDEFSETGQLWGNPIYDWKAMDKDGYSWWVERLRESFKIYDIVRIDHFRGF
ESYWEIPADSETAATGKWVKGPGYALFKAVKEALGELNIIAEDLGFMTDEVIELREKTGF
PGMKILQFAFNPDDESIDSPHLAPHNSVMYTGTHDNNTVLGWYKDEIDDPTREYLAVYTN
RKEYETVPHAMLRTIFASVSYMAIATMQDLLELDGSARMNLPSTIGGNWQWRMTEDELSK
EVEAELLSLTTIYRRINTKLKAKNNVNQNSKGEKNV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacgtcaaagtggtgttctcatgcatatttcttctttgccagggaaatacgga
attggatcttttgggaaaagtgcgtatgattttgtagatttcttggtaagaactaagcaa
cgctattggcagattttgccactaggcacgactagctatggagactctccttaccaatct
ttttctgctttcgcaggaaatactcactttattgacttagatcttcttataaaagaaggt
ttgcttcaagaaagtgatttagatggtgtggattttggaagtgatcccaaagctgttgac
tatgctaagattttcgaagcacgtcggccattattggaaaaagctgttaaaaatttcctt
caaagctctgatttgaaagcttataaaaaatttgttgcagacaatgctaactggttagac
ctgtacgttgattatatggccatcaaagagcactttgatttggcagcgtggacagagtgg
tctgatgaagacattcgcctgcgtaagccagatgccttggctgattaccgtgagcgcctg
agcgaacagatggaataccatcgtgttacgcaatacttcttcttccaacaatggctggct
ttaaaagattatgcgaataagcatcatattgatattgtcggagatatgccaatctatgta
gcagcagacagtgctgatgtttgggcacaaccacatttctttaaaacagacgctgttggt
aaaccaacttgcgtggcaggatgtccgcctgatgaattctcagaaacaggacagctttgg
gggaacccaatctatgactggaaagctatggataaagatggatattcttggtgggttgag
cgcttgcgcgagagctttaagatttatgacatcgttcgtattgaccatttccgcggattt
gaatcttattgggaaatcccagcggattcagaaacagctgcaactggtaagtgggtaaaa
ggacctggctatgctctctttaaagctgttaaagaagctttgggagaactaaatatcatt
gctgaagacctaggctttatgactgatgaagttattgagttgcgtgagaaaactggtttc
ccagggatgaagattttgcagtttgccttcaatccagatgatgaaagcatcgatagccca
cacttggcgcctcataactcagtaatgtatacaggaactcatgataataatactgttctt
ggctggtataaggatgagattgatgatccaactcgtgaatacttagctgtttataccaac
cgtaaagaatacgaaactgttcctcatgcaatgctccgtacgatctttgcttctgttagc
tatatggcaatcgcaaccatgcaagatctgctagaattagatggttcagcaagaatgaac
ttgccatccactattggtggcaactggcaatggcgtatgacagaagatgaattgtctaaa
gaggtagaggcagagttgctctctctaacaactatttatcgccgaattaatacaaaactt
aaagcaaaaaacaatgtaaatcagaattccaaaggagaaaaaaatgtctaa

DBGET integrated database retrieval system