KEGG   Streptococcus gordonii: SGO_0113Help
Entry
SGO_0113          CDS       T00594                                 

Gene name
acdH
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGO_0113 (acdH)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0113 (acdH)
   00620 Pyruvate metabolism
    SGO_0113 (acdH)
   00650 Butanoate metabolism
    SGO_0113 (acdH)
  Lipid metabolism
   00071 Fatty acid degradation
    SGO_0113 (acdH)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGO_0113 (acdH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGO_0113 (acdH)
   00626 Naphthalene degradation
    SGO_0113 (acdH)
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGO_0113 (acdH)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SGO_0113 (acdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119851..122502
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLAAEKHVDELVQKALVALDEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVEEFKSYHTYFVNKKEKALLEEFCFGA
KANSKNCAGAKLNADIVGKPAAWIAEQAGFTVPEGTNILAAECKEVGEKEPLTREKLSPV
IAVLKSDSREDGINKARKMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPEPDITTV
ERGTEIMRSFKPDTIIALGGGSPMDAAKVMWLFYERPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERVGIQMNFKAQGIDEKEWKKHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDSYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacacctgaggaaaagaaactcgcagctgaaaagcatgta
gatgagttagtacaaaaagccttggttgctcttgatgaaatgcgcaaattagaccaagaa
caagtcgactacatcgtagctaaagcttctgttgcagcacttgatgcccatggagaattg
gcgcttcatgcttatgaagaaacaggtcgtggggtctttgaagataaggcaacaaaaaac
ctattcgcctgtgaacacgtggtaaacaacatgcgtcacacgaagactgttggtgttatc
gaagaagatgatgtaacaggtttaactttgattgctgagccggttggtgttgtctgcggg
attactcctacaacaaacccaacttcaactgcaatctttaagtctttgatttcattgaag
actcgtaacccaattgtctttgctttccacccatctgctcaagaatcatctgcacatgca
gctcaaatcgttcgtgatgcagcaatcgcagcaggtgctcctgaaaactgtgttcaatgg
attacccaaccatctatggaagcaactagcgctcttatgaaccatgaaggagtggcaacg
atccttgcaactggtggtaatgcaatggtgaaggcagcttactcatgtggcaagccagct
cttggggttggtgccggaaacgtaccagcttatgtggaaaaatccgctaatatccgtcaa
gcagcgcacgatatcgttatgtctaagtcctttgacaatggtatggtctgtgcctctgag
caagccgttatcattgataaggaagtttatgacgaatttgtagaagagttcaaatcttat
catacttactttgtaaataagaaagaaaaagctctgttggaagaattctgcttcggtgct
aaggcaaacagtaagaactgtgctggtgcgaagcttaatgcagatatcgtaggtaagcca
gcagcttggattgcagaacaagcaggatttacagttccagaaggaaccaatatccttgct
gcagaatgtaaagaagttggcgaaaaagagccgttaactcgtgaaaaattatctccagtt
atcgcagttttgaaatctgatagtcgtgaagacggaattaacaaggctcgtaaaatggtt
gaatttaacggtcttggtcactcagcagcgatccatactgcagatgaagaattaactaaa
gaatttggtaaagcagttaaagctattcgtgttatctgtaactcaccttctactttcggt
ggtatcggggacgtttataatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggagataacgtcagcgccatcaacctcttgaacatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gactcaattcaataccttcaaaaatgtcgtgacgttgagcgtgtcatgatcgttacagac
catgctatggtagagcttggtttcctagatcgtatcatcgagcaactcgatcttcgtcgt
aataaggttgtttatcaaatctttgctgacgtagaaccagagccagatatcacaacagtt
gaacgtggtacagagatcatgcgttccttcaaacctgatacaatcattgcacttggtggt
ggttcaccaatggacgcagctaaagtaatgtggctcttctatgaacgaccagaagttgac
ttccgtgaccttgttcaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaagtttatcgcaatcccaacaacatctggtacaggatctgaagta
acaccgtttgccgttatctctgataaggctaacaaccgtaaatacccaatcgctgactac
tcattgactcctactgtagccatcgtagacccagctttggtattaacagttccaggattt
gttgctgcggacactggtatggacgtattgacccacgctactgaagcatacgtatctcaa
atggctagtgactacactgatggtcttgcccttcaagcaatcaaacttgtctttgaaaac
cttgaaagctctgtgaagaatgcagatttccattcacgtgaaaagatgcataatgcttca
acaatcgctggtatggcctttgccaatgctttcttgggtatttctcactcaatggctcat
aagattggtgcgcaattccacacaatccacggtcgtaccaatgctatcttgctgccatac
gtaatccgttacaatggtacacgtccagctaagacagcgacatggcctaagtacaactac
taccgtgcggatgaaaaataccaagatatcgctcgtatgcttggtttaccggcttctact
ccagaagaaggtgtggaatcttacgcaaaagctgtctacgaacttggtgagcgcgttggt
atccaaatgaacttcaaggctcaaggaattgatgaaaaagaatggaagaaacattctcgt
gaattggctttccttgcttatgaagatcaatgttcgcctgctaacccacgtcttccaatg
gttgaccatatgcaagaaatcatcgaagattcttactacggttacaaagaacgtccagga
cgtcgcaaataa

DBGET integrated database retrieval system