KEGG   Streptococcus gordonii: SGO_0139Help
Entry
SGO_0139          CDS       T00594                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGO_0139 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGO_0139 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SGO_0139 (thrC)
Enzymes [BR:sgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SGO_0139 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
144806..146290
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNRVTASQAILQGLATDGGLFTPITYPQVDLDFAKLKDASYQEVAKLVL
SAFLDDFSEAELDHCINHAYDSKFDDAAIAPLVKLDGQYNLELFHGATIAFKDMALSILP
HLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDTDLRARLLEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEITAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTQVYDKKRSFKVTSSPSMDILVSSNLERLIFHLSGNSAEKTATLMAALNEHGQYELT
DFDAEILELFAADYATEQETAAEIKRVYQASDYIEDPHTAVASAVYQKYLAETGDQRKTV
IASTASPYKFPVVAVEAVTGQTGLSDFEALDQLHELSGVALPPAVDGLETAPVRHKTTVA
ADQMQTAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactttagtttatcaatcaacacgtgacgaaaagaatagagtaacagccagccaggcg
attttgcaaggtttggcgacagacggaggcctttttacgcccattacctatccgcaggtc
gatttggattttgctaagctcaaagacgcttcttatcaggaagtagccaagctggtttta
tctgcctttttagatgatttttctgaagcggagctggaccactgtatcaaccatgcctac
gacagcaagtttgatgatgcagcgattgctcccttggtcaagctggatggtcagtacaat
ctagagcttttccacggagcgaccattgccttcaaggatatggctttgtctatcctgcct
cacctgatgacaactgcagccaaaaagcacggcttggaaaacaaaattgtcattttgacg
gcaacttctggagacacaggcaaggcggctatggcaggctttgcggacgttccaggaact
gaaattattgtcttttatccgaaagatggtgtcagcaaggtccaagagttgcaaatgacg
acgcagacaggtgctaatacgcatgtagttgccattgatggcaattttgatgatgcccag
actaatgtcaagcacatgttcaatgacacagacctacgagctcgtctcttggagcacaaa
ctccagttttcatcagctaactctatgaatatcggccgtttggtgccacagattgtctac
tatgtctacgcttacgctcagctagtgaagacaggagaaatcacagcaggagacaaggtc
aactttacagttccgacaggaaactttggtaatatcttggcggcctactatgccaagcaa
attggtctgccagttggcaagctaatctgtgcatcaaatgaaaacaatgtcctgacggac
ttcttcaagactcaggtttatgacaagaagcggagcttcaaggtgacgtctagtccgtct
atggatattctggtttcctctaacttggagcgtttgattttccatctgtctggtaacagc
gcagagaaaacagctaccctgatggcggctttgaatgagcatggtcagtatgaactgacg
gactttgacgctgagattttagagctctttgcggctgattatgcgacagagcaagaaaca
gctgctgaaatcaagcgggtctatcaagcatctgattacatcgaagacccacatacggcc
gttgcatccgctgtctatcaaaaatacttggcagagacaggtgatcagcgcaagactgtt
atcgcgtctaccgctagtccttataagttcccagttgtggctgttgaggctgtgactggc
caaacaggacttagtgacttcgaggctttggaccaactgcacgaactttctggcgtagcc
cttccaccagctgtggatggcttagaaacagcaccagttcgccacaaaacgacggttgct
gcagaccaaatgcaaacagcagtcgaggattacttaggattataa

DBGET integrated database retrieval system