KEGG   Streptococcus gordonii: SGO_0139Help
Entry
SGO_0139          CDS       T00594                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgo  Streptococcus gordonii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sgo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:sgo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
144806..146290
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNRVTASQAILQGLATDGGLFTPITYPQVDLDFAKLKDASYQEVAKLVL
SAFLDDFSEAELDHCINHAYDSKFDDAAIAPLVKLDGQYNLELFHGATIAFKDMALSILP
HLMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGANTHVVAIDGNFDDAQTNVKHMFNDTDLRARLLEHKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEITAGDKVNFTVPTGNFGNILAAYYAKQIGLPVGKLICASNENNVLTD
FFKTQVYDKKRSFKVTSSPSMDILVSSNLERLIFHLSGNSAEKTATLMAALNEHGQYELT
DFDAEILELFAADYATEQETAAEIKRVYQASDYIEDPHTAVASAVYQKYLAETGDQRKTV
IASTASPYKFPVVAVEAVTGQTGLSDFEALDQLHELSGVALPPAVDGLETAPVRHKTTVA
ADQMQTAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactttagtttatcaatcaacacgtgacgaaaagaatagagtaacagccagccaggcg
attttgcaaggtttggcgacagacggaggcctttttacgcccattacctatccgcaggtc
gatttggattttgctaagctcaaagacgcttcttatcaggaagtagccaagctggtttta
tctgcctttttagatgatttttctgaagcggagctggaccactgtatcaaccatgcctac
gacagcaagtttgatgatgcagcgattgctcccttggtcaagctggatggtcagtacaat
ctagagcttttccacggagcgaccattgccttcaaggatatggctttgtctatcctgcct
cacctgatgacaactgcagccaaaaagcacggcttggaaaacaaaattgtcattttgacg
gcaacttctggagacacaggcaaggcggctatggcaggctttgcggacgttccaggaact
gaaattattgtcttttatccgaaagatggtgtcagcaaggtccaagagttgcaaatgacg
acgcagacaggtgctaatacgcatgtagttgccattgatggcaattttgatgatgcccag
actaatgtcaagcacatgttcaatgacacagacctacgagctcgtctcttggagcacaaa
ctccagttttcatcagctaactctatgaatatcggccgtttggtgccacagattgtctac
tatgtctacgcttacgctcagctagtgaagacaggagaaatcacagcaggagacaaggtc
aactttacagttccgacaggaaactttggtaatatcttggcggcctactatgccaagcaa
attggtctgccagttggcaagctaatctgtgcatcaaatgaaaacaatgtcctgacggac
ttcttcaagactcaggtttatgacaagaagcggagcttcaaggtgacgtctagtccgtct
atggatattctggtttcctctaacttggagcgtttgattttccatctgtctggtaacagc
gcagagaaaacagctaccctgatggcggctttgaatgagcatggtcagtatgaactgacg
gactttgacgctgagattttagagctctttgcggctgattatgcgacagagcaagaaaca
gctgctgaaatcaagcgggtctatcaagcatctgattacatcgaagacccacatacggcc
gttgcatccgctgtctatcaaaaatacttggcagagacaggtgatcagcgcaagactgtt
atcgcgtctaccgctagtccttataagttcccagttgtggctgttgaggctgtgactggc
caaacaggacttagtgacttcgaggctttggaccaactgcacgaactttctggcgtagcc
cttccaccagctgtggatggcttagaaacagcaccagttcgccacaaaacgacggttgct
gcagaccaaatgcaaacagcagtcgaggattacttaggattataa

DBGET integrated database retrieval system