KEGG   Streptococcus gordonii: SGO_0163Help
Entry
SGO_0163          CDS       T00594                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgo  Streptococcus gordonii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGO_0163 (galU)
   00052 Galactose metabolism
    SGO_0163 (galU)
   00500 Starch and sucrose metabolism
    SGO_0163 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SGO_0163 (galU)
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGO_0163 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(173267..174175)
Genome map
AA seq 302 aa AA seqDB search
MSKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIDDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIGLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDKAMPLTKQLMNDYEATHASTIAVMEVPHEEVSSYGVIAPQG
EGLNGLYSVEKFVEKPSPEEAPSNLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAIDT
LNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDDLEQYIIELGKKLEEKTKK
QN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttaagaaagctgtcattccagcagcgggtcttggaactcgtttcctacct
gctactaaggcgcttgctaaagaaatgttacctatcgtggacaagcctaccattcaattt
attgttgaagaagctctcaagtcaggtattgatgatattttagtcgtaacgggtaagtca
aaacgttcgattgaggatcatttcgattccaattttgaacttgaatacaatctcaaagaa
aaaggcaaagatgaccttttgaaattagttgatgaaaccactggtattggcctgcacttc
attcgacaaagtcatccgcgtgggctgggagatgctgtgcttcaagccaaggcttttgtc
ggcaacgaaccttttgttgtcatgttaggtgatgaccttatggatatcactaatgataaa
gctatgccacttactaaacagctgatgaacgactatgaagcaacccacgcttctactatt
gcggttatggaagtccctcatgaagaagtttcttcatatggtgtcatcgctccgcaaggc
gaaggtcttaatggactttatagtgtcgaaaaatttgttgaaaaaccaagtccagaggaa
gctccaagtaatttagcaattattggtcgctatttgcttactccagaaatctttgaaatc
ttggaaaatcaagctcctggtgctggaaatgaaatccagctgacggatgccattgatact
cttaacaagacccagcgcgtatttgcccgtgaatttaagggagatcgctacgatgttggt
gataagtttggcttcatgaaaacatctattgattatgctctcaaacatccacaagtcaaa
gatgatttggaacaatatattattgaacttggtaaaaagctagaagagaaaactaaaaag
caaaactaa

DBGET integrated database retrieval system