KEGG   Streptococcus gordonii: SGO_0163Help
Entry
SGO_0163          CDS       T00594                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00040  Pentose and glucuronate interconversions
sgo00052  Galactose metabolism
sgo00500  Starch and sucrose metabolism
sgo00520  Amino sugar and nucleotide sugar metabolism
sgo01100  Metabolic pathways
sgo01130  Biosynthesis of antibiotics
Module
sgo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SGO_0163 (galU)
   00052 Galactose metabolism
    SGO_0163 (galU)
   00500 Starch and sucrose metabolism
    SGO_0163 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SGO_0163 (galU)
Enzymes [BR:sgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SGO_0163 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABV10363
UniProt: A8AUM4
Position
complement(173267..174175)
Genome map
AA seq 302 aa AA seqDB search
MSKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIDDILVVTGKS
KRSIEDHFDSNFELEYNLKEKGKDDLLKLVDETTGIGLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNDKAMPLTKQLMNDYEATHASTIAVMEVPHEEVSSYGVIAPQG
EGLNGLYSVEKFVEKPSPEEAPSNLAIIGRYLLTPEIFEILENQAPGAGNEIQLTDAIDT
LNKTQRVFAREFKGDRYDVGDKFGFMKTSIDYALKHPQVKDDLEQYIIELGKKLEEKTKK
QN
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagttaagaaagctgtcattccagcagcgggtcttggaactcgtttcctacct
gctactaaggcgcttgctaaagaaatgttacctatcgtggacaagcctaccattcaattt
attgttgaagaagctctcaagtcaggtattgatgatattttagtcgtaacgggtaagtca
aaacgttcgattgaggatcatttcgattccaattttgaacttgaatacaatctcaaagaa
aaaggcaaagatgaccttttgaaattagttgatgaaaccactggtattggcctgcacttc
attcgacaaagtcatccgcgtgggctgggagatgctgtgcttcaagccaaggcttttgtc
ggcaacgaaccttttgttgtcatgttaggtgatgaccttatggatatcactaatgataaa
gctatgccacttactaaacagctgatgaacgactatgaagcaacccacgcttctactatt
gcggttatggaagtccctcatgaagaagtttcttcatatggtgtcatcgctccgcaaggc
gaaggtcttaatggactttatagtgtcgaaaaatttgttgaaaaaccaagtccagaggaa
gctccaagtaatttagcaattattggtcgctatttgcttactccagaaatctttgaaatc
ttggaaaatcaagctcctggtgctggaaatgaaatccagctgacggatgccattgatact
cttaacaagacccagcgcgtatttgcccgtgaatttaagggagatcgctacgatgttggt
gataagtttggcttcatgaaaacatctattgattatgctctcaaacatccacaagtcaaa
gatgatttggaacaatatattattgaacttggtaaaaagctagaagagaaaactaaaaag
caaaactaa

DBGET integrated database retrieval system