KEGG   Streptococcus gordonii: SGO_0297Help
Entry
SGO_0297          CDS       T00594                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sgo  Streptococcus gordonii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGO_0297 (arb)
Enzymes [BR:sgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SGO_0297 (arb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
317247..318686
Genome map
AA seq 479 aa AA seqDB search
MTEKLTFPDGFLWGGATAANQCEGAYDADGRGLANVDVVPIGEDRLAIITGKKKMFDFEE
GYFYPAKEAIDMYHRFKEDIALFGEMGFKTYRLSIAWSRIFPKGDELEPNEAGLKFYEDL
FKECHKYGIEPLVTITHFDCPMHLIEQYGGWRSRKMLEFYERLCRTLFTRYKGLVKYWLT
FNEINMILHAPFMGAGLCFEEGENEEQVKYQAAHHELVASAIATKLAHEIDPENKVGCML
AAGQNYPNTCHPRDVWAGMEEDRKNYFFIDVQARGEYPNYAKKAWEREGITVEMTEEDLR
LLKEHTVDFISFSYYSSRVASGDPKVNELTEGNIFASLKNPYLEASEWGWQIDPLGLRIT
LNTIWDRYQKPMFIVENGLGAVDTPDENGYVADDYRIDYLAAHVKAMREAINEDGVVLWG
YTTWGCIDLVSAGTGEMKKRYGFIYVDRDNEGKGTLKRSKKKSFDWYKEVIATNGASVK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaactgacttttcctgatggttttttgtggggtggagcgacagctgccaac
caatgcgagggcgcttatgatgcggatggccgtgggctggccaatgtagatgtggtgccg
attggtgaggaccgtctggccatcatcacaggtaagaaaaagatgtttgactttgaggag
ggctatttctatccggccaaggaagctattgacatgtaccatcgctttaaggaggacatt
gccctctttggcgagatgggctttaagacttatcgtctgtccattgcttggagcaggatt
ttccctaagggggatgagctggagcccaatgaagctggcttgaaattttacgaagacctc
tttaaggaatgccataagtacggcattgagcccttggtgaccattactcactttgactgt
cctatgcacttgattgagcaatatggtggttggcggagccgtaagatgctggaattttac
gagcgtctctgccgcactctctttacccgttacaagggcttggtcaaatactggctgacc
ttcaatgaaattaacatgatcctccatgcaccatttatgggggcggggctctgctttgaa
gaaggcgaaaatgaagagcaggtcaagtatcaagcggcccatcatgagctggtcgcgtca
gccattgctaccaagctggctcatgagattgatccggaaaataaggttggctgtatgctg
gcggcagggcaaaattatcctaatacctgccatccacgcgatgtatgggctggcatggag
gaagacaggaaaaactatttctttatcgatgtgcaggcgcgtggtgaataccctaactac
gccaagaaagcttgggagcgcgagggtatcactgttgaaatgacagaagaagacctgcgg
ctactcaaggagcatacggtggacttcatttccttctcatactactctagccgggtggct
tcgggcgatcctaaggtcaacgagctgactgagggtaatatctttgcttctctcaagaac
ccttatttggaagcttctgagtggggctggcagattgatccactgggcttgcgaattacg
cttaataccatctgggatcgctatcaaaagcccatgtttatcgtggaaaatggtctgggt
gcagtggatactccagatgaaaatggctatgtagctgatgattaccggattgactatctg
gctgcccatgtcaaggctatgcgggaagccatcaatgaggacggtgtggtgctgtggggc
tacacgacctggggttgtatcgacctggtatcagccggcactggcgagatgaagaagcgc
tacggctttatctatgtggaccgggacaatgaaggtaagggaacactcaaacgctctaag
aagaaatcctttgactggtacaaggaagtcatcgcgactaacggagcatctgtgaaatag

DBGET integrated database retrieval system