KEGG   Streptococcus gordonii: SGO_0348Help
Entry
SGO_0348          CDS       T00594                                 

Definition
reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sgo  Streptococcus gordonii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SGO_0348
   00670 One carbon pool by folate
    SGO_0348
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SGO_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380122..380643
Genome map
AA seq 173 aa AA seqDB search
MAVYFYGCITMDGYLADSQHRIDWLHQLGSVEDTGYDDFYRQMDITIMGKRTFEEIQDLQ
DVESFYQATENYVFTHDRHLSVSNYQPVAGDVVDFVHQIDKGKNVFVIGGNSLVRPLLDA
DLFDHLIIQIAPLILGKGVPLFTQEEGQRFYQLDSLRQFGPFAELVFSRKSQK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagtatatttttacggctgtatcaccatggatggctacttggcagacagtcagcac
aggatagactggctgcatcagcttggttctgtagaggatacaggctatgatgacttttac
aggcaaatggatatcaccatcatgggcaagcggacctttgaggaaatccaagatttgcaa
gatgtagaaagtttttatcaagctacggaaaactatgtctttacgcatgataggcacctg
tctgtcagcaattaccagccagtagctggggatgtggtggactttgttcaccagattgac
aaaggcaaaaatgtctttgtgattggtggtaattccttggtaagaccgctcttggatgcg
gatcttttcgaccacctcattattcagatagcgccccttatcctaggaaagggggttccc
ctctttacccaagaggaagggcagcgcttttaccaactggatagcctcagacaatttggc
ccttttgcagagctggttttcagccgaaaaagtcagaaatag

DBGET integrated database retrieval system