KEGG   Streptococcus gordonii: SGO_0348Help
Entry
SGO_0348          CDS       T00594                                 

Definition
(GenBank) reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sgo  Streptococcus gordonii
Pathway
sgo00670  One carbon pool by folate
sgo00790  Folate biosynthesis
sgo01100  Metabolic pathways
Module
sgo_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SGO_0348
   00670 One carbon pool by folate
    SGO_0348
Enzymes [BR:sgo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SGO_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RibD_C DHFR_1 VipB
Motif
Other DBs
NCBI-ProteinID: ABV09679
UniProt: A8AV57
Position
380122..380643
Genome map
AA seq 173 aa AA seqDB search
MAVYFYGCITMDGYLADSQHRIDWLHQLGSVEDTGYDDFYRQMDITIMGKRTFEEIQDLQ
DVESFYQATENYVFTHDRHLSVSNYQPVAGDVVDFVHQIDKGKNVFVIGGNSLVRPLLDA
DLFDHLIIQIAPLILGKGVPLFTQEEGQRFYQLDSLRQFGPFAELVFSRKSQK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagtatatttttacggctgtatcaccatggatggctacttggcagacagtcagcac
aggatagactggctgcatcagcttggttctgtagaggatacaggctatgatgacttttac
aggcaaatggatatcaccatcatgggcaagcggacctttgaggaaatccaagatttgcaa
gatgtagaaagtttttatcaagctacggaaaactatgtctttacgcatgataggcacctg
tctgtcagcaattaccagccagtagctggggatgtggtggactttgttcaccagattgac
aaaggcaaaaatgtctttgtgattggtggtaattccttggtaagaccgctcttggatgcg
gatcttttcgaccacctcattattcagatagcgccccttatcctaggaaagggggttccc
ctctttacccaagaggaagggcagcgcttttaccaactggatagcctcagacaatttggc
ccttttgcagagctggttttcagccgaaaaagtcagaaatag

DBGET integrated database retrieval system